KEGG   Clostridium aceticum: CACET_c04920Help
Entry
CACET_c04920      CDS       T03971                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cace  Clostridium aceticum
Pathway
cace00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CACET_c04920 (bdhA)
Enzymes [BR:cace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CACET_c04920 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CACET_c04920 (bdhA)
    1.1.1.-  
     CACET_c04920 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 NAD_binding_3 NAD_binding_7 AlaDh_PNT_C 2-Hacid_dh_C Shikimate_DH F420_oxidored Sacchrp_dh_NADP DapB_N ThiF AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AKL94002
UniProt: A0A0D8IEA8
Position
522500..523555
Genome map
AA seq 351 aa AA seqDB search
MKAAVWYGKKDVRIMEVPEPPAPGKGKVKIKVQWCGICGSDLHEYLAGPIFIPTEPHPLT
GDTAPIILGHEFSGEIVEIGPGVEGFKVGDRVAPDACQVCHICNPCKIGKYNVCEKLAFT
GLMTNGAFAEYVVVPDYTLYKIPDNMTYETAALLEPISVGIHAVRQAPILQGENVVIFGA
GAIGLATLQAVRAAGASKIYVVEVAKARKAYAKQMGATEVLDPNEVDIRKKIKEVTKGVG
TDVVFECIGSEKVTPLAVEVARTGGKIVVVGVYEKETSLNFNSIVFKDKHIIGSLAYAGD
FEIAIDLMNDGRIQADPLITGKIKIDDLVEKGFNELVHRKEENIKILVTPW
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtatggtatggaaaaaaagatgttagaatcatggaggtacctgagccg
ccagcaccaggcaagggtaaagtaaaaattaaagtccaatggtgtggtatatgcggttca
gatctacacgagtatttagcagggcctatttttattccaacagaaccccacccattaaca
ggggatacggctcctatcattcttgggcatgagttttcgggagagattgttgaaatagga
ccaggcgttgaaggtttcaaagtaggcgacagagttgcacccgatgcatgtcaagtttgt
catatctgcaatccctgcaaaattggaaagtataacgtttgtgaaaaactagcttttacc
ggcttgatgacaaatggcgcctttgcagagtatgttgttgttcctgattatactctctat
aaaattccagacaatatgacctatgaaacagcagccctactggaaccgatttctgtagga
attcatgcagtacggcaagcaccaattctccagggggaaaacgttgtgatattcggggca
ggagcaattggcttagccacacttcaggcagttcgtgctgcaggtgccagcaaaatatat
gtggtggaagtagcgaaggctagaaaagcttatgcaaagcaaatgggagccactgaagtc
cttgatccaaatgaggtggatattaggaagaaaattaaagaagtcactaagggtgtagga
acagatgtggtttttgaatgtattggcagtgaaaaggtaacccctctagctgtggaagtg
gctaggacaggtgggaaaattgtagtagtcggtgtttatgaaaaagaaaccagcctgaat
ttcaacagtattgtatttaaagataagcatattattggttccttggcttatgctggagat
tttgaaattgcaattgatctaatgaatgatggacgtattcaggcggatcccttaattacc
ggaaaaatcaaaatagatgatttagtagaaaaggggttcaacgaattagttcatcgtaag
gaggaaaatattaaaattttggtcacgccttggtag

DBGET integrated database retrieval system