KEGG   Clostridium aceticum: CACET_c17510
Entry
CACET_c17510      CDS       T03971                                 

Gene name
oraS
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit alpha
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cace  Clostridium aceticum
Pathway
cace00472  D-Arginine and D-ornithine metabolism
cace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CACET_c17510 (oraS)
Enzymes [BR:cace01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CACET_c17510 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AKL95199
UniProt: A0A0D8ICQ6
Position
1820037..1820405
AA seq 122 aa
MKRSDDFQQRRQHLKDLSDEALEKKFWELAEKIVDPMIDLARKHTTPSIERSVLLRMGFS
SIEAKAIVEAVIDRGLMGKGAGHVVYRLAKEKGLDIREAGLQLVEGKLWDEVVVMFKGGA
KK
NT seq 369 nt   +upstreamnt  +downstreamnt
gtgaaaaggtcagatgattttcaacaaagaaggcaacacttaaaggatttaagtgatgag
gcattagaaaaaaaattttgggaattagcagagaagattgtagatccaatgatagattta
gcaagaaaacatactaccccttctatagaaaggtctgttttgttgcgtatgggcttttcc
agtatagaggcaaaagctatcgtagaagctgtgatagatcgtggactgatgggaaaaggt
gctgggcatgtagtatatagattagcaaaagaaaaaggtttagatataagagaagctggt
ctccaattggtggagggaaaactatgggatgaagttgtggttatgtttaaagggggtgca
aagaaatga

DBGET integrated database retrieval system