KEGG   Clostridium aceticum: CACET_c17520
Entry
CACET_c17520      CDS       T03971                                 

Gene name
oraE
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit beta
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
cace  Clostridium aceticum
Pathway
cace00472  D-Arginine and D-ornithine metabolism
cace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CACET_c17520 (oraE)
Enzymes [BR:cace01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CACET_c17520 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AKL95200
UniProt: A0A0D8IDA3
Position
1820402..1822612
AA seq 736 aa
MNLKPNEKLDVKAILKDLDKYTPKRRGWVWRKKEENLQMGPFVYKDASIPLEQSTPLPSA
KYFGDIDPQPDSVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLIEGTP
QGIGGIPITRKQVRAQRKALDFIEEEVGRPINYHSYISGVAGPEIAVMFAEEGVNGAHQD
PQYNILYRNINMIRSFVDAAEAKQSMIWADIAQIDGAHNANATAREAWKVMPELMVQHAI
NSMYSVKVGMKKENICLSTVPPTAPPAPCMTLDLPYAVALRELFKEYKMRAQMNTKYMES
STREATVTHVLNLLISRLTRADIQSTITPDEGRNVPWHIYNIEACDTAKQALVGMDGLME
MIQLKDTGMLRDQARELKERAVLFMEEVLETGGYFDAVEAGFFVDSGYYPERNGDGITRK
IDSGIGVGTVYEREEDYLAPVTAHFGYNNVAQYDPSAVEVASRLIDGCTFEKSEKIIFID
ELDETDNVNVRLEETKELRESTSIKPEVEWMGDGYVMLNLFLPLPKRVAQFAAIEIAKKM
GLEDVEVIHKEEMHPSEGTRIELKGRVGFTIDVEELVIPPEPTIMSEDEIREKIKDQPMK
IVAGTVGEDEHSVGLREIIDIKHGGIEKYGIECHYLGTSVGIEKLVDAAIELNADAILAS
TIISHDDIHYKSMKKIHELCIEKGIRDNIMILCGGTQVTPELAVRQGVDAGFTRGTKGVH
VATFLVKRRREMQNEG
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgaatctaaaaccaaatgaaaaattagatgttaaagctatattaaaggatttagataaa
tacacaccaaagcgtagagggtgggtatggagaaaaaaagaagaaaacttacaaatggga
ccctttgtttataaagatgcttctatacccctagagcaaagtacaccactaccctcagca
aagtattttggtgatattgatccccagccagattcagtaataacaacagaaattgcttct
ggaagatttgaagatgatattcgtcgtatgaggatggcggcatggcacggagcagatcac
atcatggtgattcgtacagccggtcaaagccactttgacggtttaatagaaggaacccct
caaggcatcggtggtatccccataactagaaagcaagtaagagcacaaagaaaagcttta
gattttattgaagaagaggtgggcagacccatcaattatcattcttatattagtggtgtt
gccgggccagaaatcgcagtgatgtttgcagaagaaggagtaaatggtgcccatcaagat
ccccagtacaatattttatatagaaatattaatatgattcgttcctttgtggatgctgct
gaagcaaaacagtctatgatttgggcagatatcgcacaaatcgatggagcccataatgct
aatgctactgctagggaagcctggaaggtaatgccagagttaatggtacagcatgcgata
aactctatgtattctgtaaaagtgggaatgaagaaggaaaatatatgcttgtccaccgtg
cctcctacagcaccaccagcaccttgtatgaccttagatttaccctatgctgtggcatta
agggaattatttaaagaatataaaatgagggcacagatgaatacgaaatatatggaatcc
tccactagagaagccactgtaacccatgtgctgaatttattaatttctagattaacgagg
gcagatattcagtctactattacaccagatgaaggaagaaatgtgccgtggcatatttat
aacatagaggcttgcgatactgcaaaacaggctttggtaggtatggatggactcatggag
atgatccaactaaaggatacgggtatgttaagggatcaggccagagaattgaaggaaaga
gcagtattgtttatggaggaggtattagaaacagggggatactttgatgccgttgaagca
ggtttttttgtagattccggctattatcccgagagaaatggggatggtattactagaaag
atagattcaggtataggtgtagggacagtctatgaaagggaggaggattatttagctcca
gtaactgctcatttcggttataataatgtagcacagtatgatccttcagcagtagaagta
gcatcaaggcttattgatggatgtacctttgaaaaatccgagaaaattatctttatagat
gagctggatgaaacagataatgtcaatgtgcgattagaagaaactaaagaattacgagaa
agcacaagtattaagccagaggtagaatggatgggggatggctatgtcatgttaaatctt
tttctgccgttgccaaaacgagttgctcagtttgccgctattgagatagcaaaaaaaatg
ggtttagaagatgtagaggtaattcataaggaggaaatgcatccttctgaaggtacaagg
atagaactcaagggaagagtaggttttactatcgatgtggaggaattggtaattccacca
gaacctaccatcatgtcagaggatgaaataagagaaaaaattaaagatcagcctatgaaa
atcgttgctggtacagtgggagaagatgaacactctgtaggcctgagagaaattatagat
attaagcatggcggcattgaaaagtatggtattgaatgtcattatttaggtacttctgta
gggatagaaaagttggtagatgccgccatagagttaaatgctgacgccatattagcctct
accatcattagtcatgatgatattcactataaaagcatgaagaagatccacgaactttgt
atagaaaaaggaatacgtgacaatataatgattctttgcggggggactcaggtgacacct
gaattggcggtaagacaaggagtagatgctggttttaccagaggaacaaagggtgtgcat
gtggctaccttcctagtgaaaagaagaagggaaatgcaaaatgaaggttaa

DBGET integrated database retrieval system