KEGG   Clostridium aceticum: CACET_c30780Help
Entry
CACET_c30780      CDS       T03971                                 

Gene name
pheC
Definition
(GenBank) cyclohexadienyl dehydratase PheC
  KO
K01713  cyclohexadienyl dehydratase [EC:4.2.1.51 4.2.1.91]
Organism
cace  Clostridium aceticum
Pathway
cace00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cace01100  Metabolic pathways
cace01110  Biosynthesis of secondary metabolites
cace01130  Biosynthesis of antibiotics
cace01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CACET_c30780 (pheC)
Enzymes [BR:cace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     CACET_c30780 (pheC)
    4.2.1.91  arogenate dehydratase
     CACET_c30780 (pheC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Cu_amine_oxidN1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AKL96522
UniProt: A0A0G3WF24
Position
complement(3263618..3264592)
Genome map
AA seq 324 aa AA seqDB search
MRYMKKSYKAPWRVGLTICIIVGVLVSNMIFSFAQNDSLSKNSVQVLVDGSVLEGVLNAS
GQTMVSAKAIGKVLGRDVTWDAASNTVKIASRLDTIIERGYIRVGTAGDYKPFTYLNPET
NEFEGYDIDAAKMLAEELGVKVEFIKTTWPTLMEDLLADKFDIAMGGISRRMSRQIQANF
SQPYIEYGKSPLIRIEDKEKYKSLEDIDQSHVHIGVNPGGTNEAFVKDNIKNAQVTVVQN
NLDIPIKVAEGEVDVMITDSIEALFYAKYDDRLYAALSDNPFTKNQMGYLFHRGDSIFAD
AINFWMDQMKLTGEFEKLSKKWVQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatatgaaaaaaagctacaaagctccatggagagtaggattaacgatttgtata
attgtaggggtgctggtatctaatatgatttttagttttgcacaaaatgatagtttaagc
aagaactctgtgcaggtgttagtagatggaagtgtgttagaaggtgtgttaaatgccagt
ggtcaaacaatggtttcagctaaagccataggaaaggtgctaggcagggatgtgacttgg
gacgcagccagtaacactgtaaagatagcatcacgacttgatactattatagagcgtgga
tatattcgagttggtactgctggggattataaaccttttacatatttaaatccagaaacc
aatgaatttgaaggatacgatattgatgcagcaaaaatgttggcagaggagttaggggtc
aaagtagagtttattaagactacatggccaactttaatggaggacttattggcagataaa
tttgatatagctatgggaggcattagccgaagaatgtcacgacaaatacaagcaaatttc
tcgcaaccatatattgagtatggcaaatctcctttgattagaatagaagataaggaaaag
tataaaagcttagaagatatcgatcagtctcatgtgcatataggagtaaatccaggtgga
accaatgaagcttttgttaaagataatataaaaaatgcacaagttactgtagtacaaaac
aatttagatattcctataaaagtagcagaaggagaagttgatgtaatgattacagatagt
atagaagcactattttatgctaagtatgatgaccgcttatatgcagctttaagtgataat
ccttttacaaaaaatcaaatgggctatttattccatagaggagatagcatttttgcagat
gctattaatttctggatggatcaaatgaagctaacaggggagtttgaaaagttaagcaag
aaatgggttcagtaa

DBGET integrated database retrieval system