KEGG   Clostridium aceticum: CACET_c33450Help
Entry
CACET_c33450      CDS       T03971                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cace  Clostridium aceticum
Pathway
cace00564  Glycerophospholipid metabolism
cace01100  Metabolic pathways
cace01110  Biosynthesis of secondary metabolites
Module
cace_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CACET_c33450 (psd)
Enzymes [BR:cace01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CACET_c33450 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AKL96789
UniProt: A0A0D8IB78
Position
complement(3535591..3536481)
Genome map
AA seq 296 aa AA seqDB search
MIYYIDRKTGAKKEEIVAGGRYLRWMHETKIGSSMLEILIKKKFLSVIYGKIQDLPISRR
KIPSFIKELDIDMREAENEDPSSYKNFNEFFIRRLKKEVRPICMDEKVFASPVDGRVMAY
ENIHAKNVLQIKGQEYCLEELLGNKGLAEEYQDGACITVRLSPADYHRFHFPDEGVPEPS
TKIAGGYYSVNPIALRKITSLYCQNKREFTVFDSYNFGKVLMVEVGATFVGSIIQTFHPN
QAVKKGDEKGYFKFGGSTVILFLQPNRIKIDRDLIENTQQGIETKVYVGEKIGIKR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatttattatatagatagaaaaacaggggcaaagaaagaagaaatagtagcaggggga
cgctacttaagatggatgcatgaaacaaaaataggtagtagtatgttggagatactgata
aagaaaaaattcctttctgttatttatgggaaaatacaggatttacctataagcagaagg
aaaattccttcctttataaaggaattggatattgatatgcgggaagcagaaaatgaagat
ccatcctcctataaaaacttcaacgagttttttataagaagattaaaaaaagaagtaaga
cctatatgtatggatgaaaaagtatttgcttctcctgtagatggtagagtgatggcttat
gaaaacatccatgcgaagaacgtattacaaataaaaggacaggagtattgtcttgaggaa
cttttgggaaataaaggattagcagaggagtatcaagacggagcctgtattaccgtcagg
ctaagcccagctgactatcaccgttttcatttccctgacgagggtgtacctgaaccttct
acaaaaattgctggtgggtactattcagtgaatcccatagctttaaggaaaatcacttct
ttatactgtcaaaacaaaagggaatttaccgtttttgattcttataattttggaaaggtt
ttgatggtggaggtgggtgccacctttgtaggctccattattcaaacctttcatccaaat
caggctgtaaaaaaaggagatgaaaaaggatactttaaatttggcggttctactgttatt
ctcttcttacaacctaatagaataaaaatcgatagggatcttattgaaaatacacaacaa
ggcattgaaacaaaagtatatgtgggagaaaaaataggtataaaaagatag

DBGET integrated database retrieval system