KEGG   Candidatus Cloacimonas acidaminovorans: CLOAM1163Help
Entry
CLOAM1163         CDS       T04769                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
caci  Candidatus Cloacimonas acidaminovorans
Pathway
caci00010  Glycolysis / Gluconeogenesis
caci00020  Citrate cycle (TCA cycle)
caci00620  Pyruvate metabolism
caci01100  Metabolic pathways
caci01110  Biosynthesis of secondary metabolites
caci01120  Microbial metabolism in diverse environments
caci01130  Biosynthesis of antibiotics
caci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:caci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOAM1163
   00020 Citrate cycle (TCA cycle)
    CLOAM1163
   00620 Pyruvate metabolism
    CLOAM1163
Enzymes [BR:caci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CLOAM1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP A_deamin
Motif
Other DBs
NCBI-ProteinID: CAO81025
UniProt: B0VI49
Position
complement(1357213..1358946)
Genome map
AA seq 577 aa AA seqDB search
MASKSSVEYYSNIKEMSPIRAIAETLMNNHLVRKVDIREAYELAKNQPGVSVTDLPMYPE
FVKLHNLPADAKVINDCHGNIVGRTAKARRFYHRLSPSLKNKLESDFREAVWQMQHYPLI
KAEAVLGMDKDLMLKATFVTTESDAANLFFWLLNFAPYESLKEEYEASPKLPIQDIILVA
FNEWTCDDDFYNNVGAPQLALVDEKHNVMVNLGMRYFGERKKGTLTMAWTSGIRIGMAAC
HGGIKEIDFSTCVNPEYHKLGKRSIAFYGLSGTGKSSHTNNADNAGTLPEGFSKVVLHDD
AFQIDLENKLCRVWEPTLFDKTDSRTVDHPDWKYTLALMNHTVLDVNGKLIPYGQDIRNS
NGRALFDRSLLGKYVNRCAFPKALVWLMKDSILPPALKLEDKYLAIAMGAALMTQRNRAE
NVAEEELNKLVFEPFANPFRVYELYRDVEAFLKVADTGADFYCFNSRGYWRESDDILEPI
PLNTSLTLQTAILMDQLQWEPWDLLPGSMIPTKESVEAILPGYYDRYHSNLRINYDKYIA
VMKDRFQQRKDFLKSSDLTERPEIQEKLIQSLQVNAD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaagagcagtgtggaatattattccaacattaaagaaatgtctcctatcaga
gctattgccgaaaccctgatgaataaccatttagttcggaaagtggatattcgcgaggca
tacgaactggcaaaaaatcaacccggcgtaagtgttaccgatttgcctatgtatccggag
tttgtaaagctgcataatctgcctgcagatgcaaaagttatcaacgattgtcatggtaac
attgttggcagaaccgctaaagcccgcagattttaccataggttaagtccttccctgaaa
aataagctggaaagtgattttcgggaagcagtgtggcaaatgcaacattatccattaatt
aaagccgaagcagttttggggatggataaagacctgatgctgaaagctacttttgtaact
actgaaagtgatgctgccaatcttttcttttggctgttgaattttgccccttatgaatcg
ttgaaagaggaatatgaggcaagtcccaagcttcctattcaggatattattctggttgct
ttcaatgaatggacttgtgatgacgatttttacaacaatgtaggggcaccacaactggct
ttggtggatgaaaaacacaatgttatggttaatctcggaatgcgttattttggggaacgg
aaaaagggaactttaactatggcttggacttccggcatcagaatcgggatggctgcctgt
catggaggaattaaagaaattgatttcagcacttgtgtaaatcctgaatatcataaattg
ggtaaaaggtctatcgctttttatggactttccggaacaggaaaatccagccataccaat
aatgcggataatgcaggaaccttgcctgagggcttttccaaggttgttttacacgatgat
gctttccagattgatttggaaaataagctatgtcgcgtttgggaaccgactttatttgat
aaaacggatagccgaaccgttgatcatcccgactggaaatatactctggctttgatgaat
catacggttttggatgttaatggcaaacttattccttacggacaggatattcgtaattcc
aatggcagagccctttttgaccgttcactattgggaaaatatgtgaaccgctgtgctttt
cccaaagcattggtttggctgatgaaggattctattttgccacctgccttaaaattggag
gataaatatttggcaatagctatgggagccgctttaatgactcagcgtaatcgtgcggaa
aatgttgccgaagaagaacttaacaagctcgtttttgaaccctttgccaatccatttcgg
gtgtatgaactctatcgcgatgtggaagcatttttaaaagtggctgatacaggtgcggat
ttttactgctttaattcgcgtggctattggagggaatcggacgatatcctggaaccgata
cctctaaatacttcgctaactctgcaaaccgctattttaatggaccagctgcaatgggaa
ccctgggatttattacctggctctatgattcctacaaaagaatccgttgaggcaatttta
ccaggctattacgacagatatcattccaacctgcgtattaactacgataaatatattgcc
gtaatgaaagacagattccagcaaagaaaggactttttaaagagcagtgatttaactgaa
agaccggaaattcaggaaaaattgatacagtcattacaggtaaatgctgattaa

DBGET integrated database retrieval system