KEGG   Candidatus Cloacimonas acidaminovorans: CLOAM1566Help
Entry
CLOAM1566         CDS       T04769                                 

Definition
(GenBank) putative UDP-N-acetylglucosamine 4-epimerase
  KO
K19997  GlcNAc-P-P-Und epimerase [EC:5.1.3.26]
Organism
caci  Candidatus Cloacimonas acidaminovorans
Brite
KEGG Orthology (KO) [BR:caci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLOAM1566
Enzymes [BR:caci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.26  N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase
     CLOAM1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NAD_binding_10 UDPG_MGDP_dh_N DUF3336
Motif
Other DBs
NCBI-ProteinID: CAO81405
UniProt: B0VFW3
Position
complement(1808071..1809063)
Genome map
AA seq 330 aa AA seqDB search
MNILITGSNGFVGSNLMWELEEDGHTVIGIDISEHCEGKKHPQTLKGDIRSLKDLNRVAS
VFLQKQQCPLELIIHCAAAKNDFGVSRQEYYSHNKYGTKTLLNFACEQGIKKLIYISSVG
VFGHPEGKANEDFPYNPDTDYGASKLAGELLCIKWQQQYPEHELIVLRPAAIFGPDNFTN
TYKLIDTLHRRPYLTIGEGNHIKTIVSIHTVIDMIRFAMQKLAPGYEHYNCIDEPYLTLK
ELMELICSHPGFQMPRFKIPLKAAIGIGRLFDIPAKLFSIDLPVNSERMRKLGTATYFTA
EKAKKDGFVQKMSLKDSITEMCDWYLSINK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctaattaccggcagtaacggtttcgtcggttccaatttaatgtgggaactg
gaagaagacgggcatactgtaatcggtattgatatcagtgaacattgcgaagggaaaaag
catccccagacgctgaaaggagatatcaggtcgctaaaggatttaaacagggttgcctct
gtttttttacaaaagcagcaatgtcctctggaactgattattcattgcgcagcagcgaag
aatgactttggcgtttcccgtcaggaatattatagtcataataaatacggcaccaaaaca
ttactgaattttgcttgtgagcaaggcatcaagaagttgatttatatcagttccgttggc
gtttttggtcatccggaaggtaaagccaatgaggattttccttataatccggatactgat
tatggcgcttcaaaactggcaggagagttgctttgtatcaagtggcaacagcaatatccg
gaacacgaacttattgttttgcgtccggcagctatttttggtcccgataattttaccaat
acttataaacttatagatactttacatagaagaccctatttaactatcggcgaaggaaat
cacattaaaaccatcgtttccatccatactgtgattgatatgattcgttttgcaatgcag
aaattagcccctggatacgaacattataactgcattgatgagccatatttaaccttgaag
gaattaatggagcttatttgttcgcatccaggtttccaaatgccccgctttaaaatcccc
ttgaaagcggcaattggcattggaagattgtttgatattcccgcgaaacttttttctata
gaccttcccgtaaatagtgagaggatgcgtaaattaggaaccgctacctattttactgct
gaaaaagccaaaaaagatggctttgtgcaaaagatgtccctaaaagatagcatcaccgag
atgtgcgattggtatctttctataaacaaataa

DBGET integrated database retrieval system