KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_00030
Entry
RN83_00030        CDS       T04624                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn00472  D-Arginine and D-ornithine metabolism
cacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    RN83_00030
Enzymes [BR:cacn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     RN83_00030
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ALD68719
Position
4672..6972
AA seq 766 aa
MTIQDTCLHHKHVREREQLGPNNKSAVTSSEPVEPRTEQDPPGPNTKLNVEEILTDLEHY
HPRRKGWTWRNVPEEGIDMGDFHYRNMSIPLKQSMPLPAAEYFENIDPQPAPVVTSEIAS
GHFEDDLRRMRMAAWHGADHIMVIRTTGQSHIDGLLEGTPEGIGGVPITRKQLRASRKAC
DLIEDEVGRPINFHSYVSGVARPEVAVLFAEEGVNGAHQDPQYNLLYRNINAYRSYVDAG
EAKKVMAGAQIFQIDGAHNANATARHGWKVMPELMVQHGLNCMYSVLVGIPKDLIGLSTV
PPSAPPAPKLWYDLPYAVALRDLFSEYKMRAQQNTRYIESDLAEAIRTHTIDTLISMLTS
ADIQSTITPDEGRNLPWHHNSVRGVQTVKQTWAALDGIKEMVTINREGPLGHMVRDLKER
AIGFLTEMLHVGGYFVAVEDGFFVDSAEFPERNHDGIARDGQGGIAEGTVVERDPDYLAP
VCDHFGNNNLPEGLNKPCDLIDGCTLCEPEKIVYIDELDPNDSAATRLACTRPFRDGTAL
RPEAEWAGDGVVLVQMNIAREAAVEMARKMGITDPQVCNLQVLHPAEGCFVEVKGQATHV
DVNPSKLTIPEKIELLPADELRQFVTDHELSVVAGTVGEDEHSVGLREILDIKHGGIEKY
GVKYRYLGTSVPVEKMVDAAIESGADAILISTIISHNDIHRTMMRKLADLATEKGIRDKV
VLVAGGTQVNREMAAETGLDATFGRGTKGIDVLDAIVRTMRTRAEA
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgactatccaagacacgtgcctgcaccacaagcacgtccgcgaacgcgagcaactcggc
ccgaataacaagtccgccgtgacgtcttcggagcccgtcgagccccgcaccgagcaggac
cccccaggcccgaataccaaactcaatgtcgaggagatcctcaccgaccttgagcactac
cacccccgtcgcaagggatggacctggcggaacgtgccggaagagggaatcgacatgggc
gacttccattaccggaacatgtccatcccgttgaagcagagcatgcctctgcccgccgca
gagtacttcgagaacattgatccccagccggcacccgtcgtcacctccgagatcgcttcg
gggcacttcgaggacgacctgcgccgtatgaggatggcggcctggcacggagctgaccac
atcatggtcatccgcaccaccggacagagccacatcgacggactactagagggcaccccg
gaaggtatcggcggcgttccgatcacccgtaaacagctgcgcgctagccgcaaggcctgc
gacctcatcgaggacgaggtagggcgccccatcaacttccactcctacgtgtccggagtc
gcccgccctgaggtggccgtcctcttcgccgaagagggggttaacggtgctcatcaagac
ccgcaatacaacctgctgtaccgcaacatcaacgcctaccgcagctatgttgacgccggt
gaagccaagaaggtgatggcgggagctcagatcttccaaatcgacggtgcacacaacgcc
aacgccactgcccggcacggttggaaggtcatgcccgagctcatggtccagcacggcctc
aactgcatgtactcagtgctggtaggaataccgaaggacctcatcggcctgtcgacggtt
ccgcccagcgctcccccggcgccgaaactctggtacgacctgccgtacgcagtggccctg
cgcgatctgttcagcgagtacaaaatgcgcgcccagcagaacacccggtacatcgagtcc
gacctcgccgaggccatccgcacccacaccatcgacactctcatctcaatgctgaccagc
gcggacatccagagcaccatcacccctgatgaaggccgcaacctgccctggcaccacaac
tctgtccgcggcgtccagacggtcaaacagacctgggccgctctcgatggcatcaaggag
atggtgaccatcaaccgcgaggggccactcggccacatggtgcgtgacctcaaggagcgg
gcgatcggtttcctcaccgagatgctgcacgtgggtggctacttcgtcgccgttgaggac
ggattcttcgtcgactcggcagaattcccggaacgcaaccacgacggcatcgcccgtgac
ggccaaggcggaatcgccgagggaaccgtcgtcgagcgtgaccccgactacctcgcccca
gtctgcgaccatttcggcaacaacaacctgcccgagggccttaacaagccgtgcgacctc
atcgacggctgcaccttgtgcgaacccgagaaaatcgtctacatcgatgagctcgacccc
aacgactcggccgcgacccgcctggcctgcacccgcccgttccgcgacggcacagcgcta
cggcccgaggctgaatgggccggtgacggtgtcgtcctggtacagatgaacatcgcccgc
gaggcggccgtcgagatggcacgcaagatgggcatcaccgacccacaggtatgcaacctg
caagtgctgcaccccgccgaaggatgcttcgttgaggtcaaaggccaggcgacccacgtc
gacgtcaacccatccaagctgacgatccccgagaagatcgaactgctacccgccgacgaa
ctacgccaattcgtcaccgaccacgagttgtcggtggtggccggcactgtcggtgaggac
gagcacagcgtcgggctgcgcgagatcctcgacatcaagcacggtggcatcgagaagtac
ggggtgaaatatcgctaccttggcacatcggtgccggtggagaagatggtcgatgccgct
atcgagagtggcgccgacgccatcctcatctccacgatcatcagtcacaacgacatccat
cgcaccatgatgcggaagttggctgatctggccaccgagaagggcatccgcgacaaggtc
gttctcgtcgccggcggcacccaggtgaaccgggagatggcagcagagaccggcttggac
gccaccttcgggcgcggtaccaagggcatcgacgtccttgacgccatcgtgcgcactatg
cggacccgcgcggaagcctga

DBGET integrated database retrieval system