KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_04285Help
Entry
RN83_04285        CDS       T04624                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn00260  Glycine, serine and threonine metabolism
cacn00630  Glyoxylate and dicarboxylate metabolism
cacn00670  One carbon pool by folate
cacn01100  Metabolic pathways
cacn01110  Biosynthesis of secondary metabolites
cacn01130  Biosynthesis of antibiotics
cacn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RN83_04285
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RN83_04285
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RN83_04285
Enzymes [BR:cacn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     RN83_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG POPLD
Motif
Other DBs
NCBI-ProteinID: ALD69409
Position
complement(923413..924528)
Genome map
AA seq 371 aa AA seqDB search
MTTLRRTPLAAVHESLGASFTDFAGWNMPVRYSSDLAEHHAVRKNAGIFDLSHMGEIRIS
GPDSGAALDYALAGKLSAVAEGRAKYSLLLTDEGGVVDDLVTYHLPDGDYLVVANAANAE
TDLAEFTKRCARFDVTVTDESAQTALVAVQGPTAVKIVLAALQKGNTTLDSDEVRDVKYY
RCLTGELDGFPVLVARTGYTGEDGYELYVPAEAAEHLWQLLMDAGGEDLTPCGLACRDTL
RLEAGMPLYGHELGTDIHPSQAGLGRVVNFKKEGDFVGRCALENRDTTADRVLVGVAGEG
RRAGRAGYAVVNEDKTVGAITSGILSPTLGHPIAMAFVDPDVAKIGTSLSVDVRGKALNT
TVVELPFYKRS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcttcgacgtacaccactggcggccgtacacgagagcctcggagcatccttc
accgatttcgcgggctggaacatgcccgtgcggtactcctccgacctggccgaacaccac
gccgtccgcaagaatgccggcatcttcgacctatcccacatgggagagatcaggatctct
ggccctgattctggagctgccctcgattacgccttggccggtaagctctccgctgtggcg
gaaggccgcgcgaagtattccctcctactcacagacgaggggggtgtcgttgatgacctc
gtgacctaccatctgcctgacggtgactacctcgtcgttgccaatgctgccaatgccgaa
actgatctcgcggaattcaccaagcgctgcgcacggttcgacgtcaccgtcacagacgag
tcagcccagaccgccctcgtcgccgtgcaaggccccacagccgtgaagatcgtgctggcg
gccctccagaagggtaataccaccctcgactccgacgaggtccgcgacgtcaagtactac
cgctgcctcaccggagaactggatggtttccccgtactcgtcgctcgcaccggttacacc
ggagaggacggctacgagctatacgttccggccgaagccgccgagcatctgtggcagctc
ctcatggacgctggcggcgaagatctcacaccgtgtggtctcgcctgccgtgacactttg
cgcctggaagctgggatgcctctctacggacacgagttgggcaccgacatccatccctct
caagccgggcttgggcgagtcgtcaatttcaagaaggagggcgactttgtcggtcgctgt
gccctcgagaaccgcgataccactgccgatcgtgtgctagtcggggtggccggggaagga
cgccgagcagggcgtgccggatatgctgtcgtgaacgaagacaaaacggtcggagccatc
acctccggcatcctctcccccactctgggccatcccatcgcaatggctttcgttgatcct
gacgtcgccaagatcggcacctcgcttagcgttgatgtgcggggcaaagccctcaacact
accgtcgtcgaattaccgttctacaagcggtcctga

DBGET integrated database retrieval system