KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_05420Help
Entry
RN83_05420        CDS       T04624                                 

Definition
(GenBank) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RN83_05420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cacn03400]
    RN83_05420
DNA repair and recombination proteins [BR:cacn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RN83_05420
    RecFOR pathway proteins
     RN83_05420
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    RN83_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_25 AAA_16 AAA_24 CobU
Motif
Other DBs
NCBI-ProteinID: ALD69591
UniProt: Q5IV60
Position
1169196..1170242
Genome map
AA seq 348 aa AA seqDB search
MAATADREKALATALQQIEKQHGKGSIMRLGEQETVKIAAIPTGSVALDVALGVGGLPRG
RIVEIYGPESSGKTTVALHAIANAQAEGGICAFIDAEHALDPEYARKLGVDTDSLLVSQP
DNGEQALEIADTLVRSGALELVVVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKMT
GALNAAGTTAIFINQLREKIGVMFGSPETTTGGRALKFYSSVRLDVRRVETLKDGSEMVG
NRTRVKVAKNKVAPPFKQAEFDILYGQGISREGSLIDMGVDCGIITKSGSWFSYNNEQLG
QGKENVRKFLKGNPDVANEIEDKILTHLGLREAEVPEGVDPRTGEVEF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaccgctgaccgcgaaaaggcccttgccacggccttgcagcagatcgagaag
cagcacggcaaaggctctatcatgcgccttggcgagcaggagaccgttaagatcgccgct
atccccacgggctcggtggccctcgacgtcgcgttgggtgtcggaggcctcccacgtggc
aggatcgtggagatctatggtcccgaatcctctggcaagacgacggtggctttgcacgca
atcgctaatgcccaggctgaaggcggcatctgtgcctttattgacgccgagcacgctctc
gacccggaatacgcacgcaaactcggggtcgatacagattccctgctggtgagccagcct
gacaatggtgagcaggctctcgagattgctgacaccctcgtccgctcgggtgccttggag
ctcgtcgttgttgactcggtggccgctctgaccccgaaggctgagatcgagggcgagatg
ggtgattcccatgttggtttgcaggcccgccttatgagccaggccctgcgcaagatgacc
ggtgcgttaaatgcggccggtaccactgccatcttcattaatcagctgcgcgagaagatc
ggtgtcatgtttggctccccggagacaacgacaggtggtcgcgccctcaagttctactcg
tccgtgcgcctcgacgtgcggcgtgtcgaaactcttaaagacggatcagagatggtcggt
aaccgcactcgtgtcaaggttgccaagaacaaggtcgccccaccttttaagcaggcagag
tttgacatcctctacggacagggcatttctcgcgagggaagcctcatcgacatgggcgta
gattgcggcatcatcaccaaatccggttcgtggttcagctacaacaatgagcagttgggt
cagggtaaggagaacgtccgaaagttcctcaaaggtaacccggatgttgccaatgagatt
gaggacaagatcctgactcacctcggcctgcgcgaagccgaggttcctgagggtgtcgat
ccccgaactggcgaggtggaattctga

DBGET integrated database retrieval system