KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_06160Help
Entry
RN83_06160        CDS       T04624                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RN83_06160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cacn03400]
    RN83_06160
Enzymes [BR:cacn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     RN83_06160
DNA repair and recombination proteins [BR:cacn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RN83_06160
    RecFOR pathway proteins
     RN83_06160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: ALD70788
UniProt: A0A371N851
Position
1333297..1333842
Genome map
AA seq 181 aa AA seqDB search
MGVDPGLTRCGVGVVEGGLGSSLKLIAVGVIRTPADLDHAHRLLRIHDGLEEWRDHTRPD
AIAVEKVFAQHNRNTVAGTAQAAGIAMMIAARHGLPVALHTPSEVKAAISGSGRADKAQV
GFMVARVLRLSAPPKPADAADAVALAICHLWRGGAARRIEAAVATQRRGRRVPRSWKDLA
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcgaccctggtttaacccggtgcggggttggcgtcgttgaaggtgggttagga
tcctccctgaagctcattgccgtgggcgtcattcgtactcctgccgacctcgatcatgca
caccgactactgcgcatccacgacgggctggaggagtggcgtgaccacacccgccccgat
gccattgccgtcgagaaagtgtttgcccagcacaaccgcaatacggtagctggtaccgct
caggcagccggaatcgcgatgatgattgccgcccggcatggtcttccagttgctcttcac
actccaagtgaggttaaagcggcaatctcgggttcaggacgagccgacaaagcccaggtg
ggtttcatggtggcacgggtgttgcggctctcggctcctcccaagcctgctgatgctgcc
gacgctgtcgccttggcgatctgccacctgtggcgtggcggggcggctcgtcgcattgaa
gctgctgtggctacgcaacgacgcggtcggcgtgtgccccgttcttggaaggacctagcc
cggtga

DBGET integrated database retrieval system