KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_06165Help
Entry
RN83_06165        CDS       T04624                                 

Definition
(GenBank) ATP-dependent DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RN83_06165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cacn03400]
    RN83_06165
Enzymes [BR:cacn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RN83_06165
DNA repair and recombination proteins [BR:cacn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RN83_06165
    RecFOR pathway proteins
     RN83_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH EccE
Motif
Other DBs
NCBI-ProteinID: ALD69709
UniProt: A0A371N7A1
Position
1333839..1334444
Genome map
AA seq 201 aa AA seqDB search
MISHFSGTVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALAPRGASASGATHVAAPWREQVAEGLVGLGWSTKDAEKAVDKVVALK
EADPAMSIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcacggtaagtgctgccggcccgacttgggtcgtccttgac
aatcatggggtcggtatcaaggtgctatgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacttccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
attaccgaagaagatgacgcaactctatgccgcgttcccggtattggtcgcaaaggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttgccccacgcggagcttcg
gcgagcggagcaacccatgtggccgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcgactaaagacgcggagaaggccgtcgacaaggtggttgctctcaag
gaagccgatccagctatgagcatcggcaacctcatgcgagcggcgttgcgtagtttggcg
cggtga

DBGET integrated database retrieval system