KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_06170Help
Entry
RN83_06170        CDS       T04624                                 

Definition
(GenBank) ATP-dependent DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RN83_06170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cacn03400]
    RN83_06170
Enzymes [BR:cacn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RN83_06170
DNA repair and recombination proteins [BR:cacn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RN83_06170
    RecFOR pathway proteins
     RN83_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 AAA_16 Sigma54_activat Mg_chelatase TIP49 AAA_22 AAA_3 Zeta_toxin AAA_14 Sigma54_activ_2 TsaE RNA_helicase NACHT IstB_IS21 NTPase_1 AAA_25 NB-ARC AAA_18 AAA_11 AAA_33 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ALD69710
UniProt: A0A371N8Z6
Position
1334492..1335520
Genome map
AA seq 342 aa AA seqDB search
MSVEHSPVDPSAEPPEKAEEAALRPGALAEFGGQQRVADQLGLVLAASKSRGTTPDHVLL
SGPPGLGKTTLAMIIASEMSAPIRISSGPAIQHAGDLAAILSSLVPGEVFFLDEIHRMSK
PAEEMLYLAMEDFRVDVVVGKGPGATAIPIEIPPFTLVGATTRAGLLPGPLRDRFGFTAQ
LDYYEVADLERIVTRSAGVIGVELAEGAAHTIASRSRGTPRIANRLLRRVRDWADVHHES
PVTPQGAETALDLYEVDPLGLDRLDRAVLHAVCLKFGGGPVGLSTLAISVGEEPQTVEEV
AEPFLVRLGFLMRTPRGRVATDRAWRHLGLEPPPDSSGEGLF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggaacactcgcccgtcgatccgtcggccgaaccccctgaaaaggctgaagaa
gcagctttacgtcctggcgcactggcagagttcggaggacaacagcgagtcgccgatcag
ctaggtctggtccttgccgcgtcgaagtcccgtggtacgacccccgaccatgttctgctg
tcgggaccgccaggtcttgggaagacgaccttggccatgattattgcctccgaaatgtcg
gcaccaatccgtatttcctcgggtcctgccattcagcacgccggggatctggctgcgatc
ttgtcctcgttagtacccggcgaagtgttctttcttgacgagatccaccggatgtccaag
cctgccgaagaaatgctttacctggctatggaggatttccgggtcgacgttgttgtgggt
aaagggccgggagctaccgcgattccgattgagataccaccgttcacgctggtgggggcg
acgacgcgagccgggctgcttccggggccgttgcgtgaccgcttcggttttactgcccag
cttgactactacgaggtagccgatctcgaacgaatcgtgacgcgatcggctggggtcatc
ggagttgagcttgctgaaggtgcggcgcacacgattgcgtcgcggtctcgcggtacgccc
cgtatcgcgaaccgcttgctgcgacgggtccgtgactgggcagacgttcatcatgagtct
cctgtgacgccgcaaggagccgagaccgcccttgacctctacgaggttgatccgttgggt
ctggaccgcctcgacagggcggttctccatgcggtgtgtctaaagttcgggggcgggccg
gtaggcttgtcaacccttgctattagcgtgggggaggaaccacagacggttgaggaagtt
gctgaacctttcctggtacgacttggttttctcatgcgcaccccgaggggccgcgtcgct
acggatcgagcttggcgacatctcggccttgaaccacctcccgacagttccggtgagggg
ctgttctga

DBGET integrated database retrieval system