KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_06345Help
Entry
RN83_06345        CDS       T04624                                 

Definition
(GenBank) primosome assembly protein PriA
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RN83_06345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cacn03400]
    RN83_06345
Enzymes [BR:cacn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     RN83_06345
DNA repair and recombination proteins [BR:cacn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RN83_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PriA_3primeBD PA26
Motif
Other DBs
NCBI-ProteinID: ALD69744
Position
1374079..1376097
Genome map
AA seq 672 aa AA seqDB search
MCPMTAPLLETTSWIAHVVVSSGLAHLDRPFDYLIPDDLVDRVQVGVRVRVKLAGRLCDG
VVVAVDHEQQPGVTLAPVEKLVSDQVVATPDQLNFARHVADHWAGTLDEVLRWAIPTRHA
MTEAANPPPWPTPMTTMPSGTLTALDRGRRFLALLKARERPRAHWRVSPVCGPGDDDHLG
DWCNGLLQAVCATLTSGRSAVVCCPTVDDVITLHARFQAVLGAGTVAVLHADQPASTRWR
HYLAVIRGTAKVVVGTRSAVMAPMADLGLIAVWDEGSDLHDEPRAPYPNTRDVAALRAQI
DHCALLLASYSCSVRSASWLGSGWLVGIGADRPTMRAVCAPVRIPGDSDIAMERDPLARS
VRLPDLAMRTIRDGLLHGPVLVSVPRVGDLVTPSCARCRTPVRCSSCGGPVTGRRTESGV
NLHCTWCGSHLPPWRCPECGSTEVRSGIVGATTTAAELGRAFPDVPVVDSSGNHVRERVD
STPRLIVATPRAEPAPESGYACAVILDAVSSLSRPGLAAVEQTVDRWMAILALVRSVRDG
GRAVIVGPSEDAALQAMVRNDPVGWATRELADRREARFPPAVPCGIVDGDPKAVASAAQR
LREWFGTDLEMLGPAPQPRRASESERDRIIVRPRSTMPLAELSQGLFRLRSKHTMSREPG
SLRVVIDPANLL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcccatgaccgcaccgctattggagacgacgtcatggatcgcccatgtcgtcgtc
tcttccggtctggcccaccttgaccgtcctttcgactatttgattcctgacgacctcgtc
gatcgagtccaggttggggtacgagtgcgggtcaaactcgccggtcggctgtgtgacggc
gtcgtggtggccgtcgatcatgagcaacagcctggggtcacgttggccccggttgaaaaa
ctggtgtccgaccaggtagttgctacaccagatcagctcaactttgcccgtcatgtggct
gaccactgggcaggaaccctggacgaggtgctcagatgggctatccctacccggcacgcc
atgacagaggcagccaatcctccaccgtggccaacgccgatgacgacgatgccgtctggg
accttgacggccttagaccgggggcgccgcttccttgcactgcttaaggcccgggaacgc
cctcgcgcccactggcgggtcagtccagtttgtggtccgggagatgatgatcacctcgga
gattggtgcaacggtttgctgcaagcagtctgtgccacgttgacgtcaggacgcagtgcg
gtggtgtgttgcccgacggttgacgacgtcatcaccctgcatgcgagattccaagctgtt
ttaggagctggaaccgtcgcggtgctccacgctgatcaaccagcgtcaacgcgctggcgc
cactacctggcagtcattcgtggcacagcgaaagttgtagtaggaactcgctcggccgtc
atggcgccaatggctgacctgggattgatcgctgtctgggatgaaggatccgacctccat
gacgaaccacgagctccatacccgaatacccgcgatgtcgctgccctgcgagcccagatt
gaccactgtgcgttgttattggcgagctattcctgttcggtgcgcagcgcctcgtggcta
gggtcaggttggctcgtcggaatcggcgcggaccgtccaacgatgagagcagtctgtgca
ccggttcgcattcccggtgactccgatatcgctatggaacgtgacccgttggcgcgatca
gttcggcttcccgatcttgctatgaggaccatccgtgatggattgttgcatggccccgtt
ctggtttccgttccgcgagttggcgatctcgtcaccccatcgtgcgcacgctgtcgaacg
ccagtgcgatgctcttcgtgcggtggaccggttaccgggcggcgtactgaatctggggtt
aacctccattgcacctggtgtggcagtcacttaccaccgtggcgctgtcccgaatgcggc
tccactgaagtgaggtcaggcattgtgggagcgacgacgacggccgcagaattgggtcgg
gcatttccagatgttcccgtggttgattcgtccggcaatcacgttcgggagagggtcgat
tcaactccccgattaatcgttgccaccccaagggccgaacccgcaccggaatcgggctat
gcctgtgctgtcatcctagatgcggtgtcctccttgtcgaggcctggcctggcggcggtg
gagcagaccgtcgatcggtggatggcaatcctggccttggtccgatcagtgcgggatggg
ggccgggcagttatcgtcggaccttcggaggacgccgccttgcaggccatggttcgaaat
gatccagtcgggtgggcgacacgtgaactcgccgatcgtcgggaggcacgtttcccgccc
gcggtgccgtgcggaattgtcgacggtgacccgaaagcggtggcttcggcggcacagcga
ctacgcgagtggttcggaaccgaccttgagatgcttggcccagctccacaaccacgccgt
gccagcgaatcggaacgggatcgaattatcgtgcgtcctcgtagcacgatgcctctcgcc
gagctttcccagggtctatttcggctacgttccaaacacactatgagccgcgaaccagga
agcttacgcgtggtcatcgacccggccaacttgttgtga

DBGET integrated database retrieval system