KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_06955Help
Entry
RN83_06955        CDS       T04624                                 

Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RN83_06955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cacn03400]
    RN83_06955
Enzymes [BR:cacn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     RN83_06955
DNA repair and recombination proteins [BR:cacn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RN83_06955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 AAA_30 PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: ALD69844
Position
1499729..1502965
Genome map
AA seq 1078 aa AA seqDB search
MTTNTSFDITRPLPQGTVLLAASAGTGKTWTISAVCAKAIATGLVHMENLLLVTFNRSAA
RELRGRVYERLVNTRLLLAGAREPSDPCDWSIIRCGQAGLTRVESALDNFDRAVITTTHE
FASRMLVELGVLSDHDPSSVLMTDLAPLATEVSDDHYLAQYLDCDRPPSVREKRELSRDV
AVKYGEVPIFSKEDADTPVQDVLWALSVREDVRRRSKSRSVHTFDDLIGDLVKALRDPYR
GPLACATLANRFGLVMVDEFQDTDPLQWEILQRAFHGHSNLWLIGDPKQSIYAFRGADIH
AYQDAAQSASHVLHLDVNYRTDKPIVEAVNTLFSNAQLGHGISTELVTAHHQESRIKTAA
TDGPRYHWSQPFQIRCLQAPAGAQLNTAASDQFVTEDLVNQVIMMLEGGTVVQDGDGSRP
LRPNDIAILVRTRRRGAELATALSQVHQPAVFSGASPVWSSQAAEDLMTLLEALENTDER
LRTRLCLSDLIGATPADLAASDSRVRSDLAIDLARWSSTWTMTGVWGTVEAALHRPGVLV
RLVSMAGGERYVTDLRQVAQKAHIAACEGRLTATATAAWIREQQQLAGDDEPRRLDSDQQ
AVIIMTVHEAKGLGFPVVLLPDITNGWAPKQSINGPIVWHDGQRRVLDISSQGTDRSIAI
ESHEEDERGENLRLLYVALTRARSAVRLWWSPCPRRHRWSAFQRLVEMDRTTGELGSGVA
GTDPGTLPWFNSGPIATVIAPANQKLLTRSVSAQPRACVVPRTLTRPLDTAFARTSYSGL
TANLHAAVSESMTNNLIDEPVDDESVDDTAPGLCGLPGGTSFGTLVHTVLEYIDTAATDL
SSEVLSITRRALRMSPLPDVPPSELATSLEQVLHSDLGPLAPGMTLADFSPADRLAEMNF
ELAMTQHGRSTTMTDLASLLCDPSLVPPDDPISGYGEILAHIPNGDQALRGFLTGSIDAV
LRRPDGRHLVVDYKTNRIPGVHKLSPHMYDAHTMRAIMFSSHYPLQGLLYSAALHRFLAS
SLPGYDPATHLGPIGYLFVRGMADRPVPDGDMPDGVFTWHPRPELIEAISEQLGGLHD
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaacacctcctttgacatcactcgaccactgccacaaggaaccgtcctgctg
gcagcaagtgccgggactggaaagacatggaccatctcggcggtgtgcgcgaaagctatc
gcgactggtctggttcacatggagaaccttctcctggtgaccttcaaccgatcagctgcc
cgcgagctgcgcggacgagtctacgaacgccttgtcaacacccgtttgctactagcaggc
gcccgagaaccctctgacccctgcgattggtcgattatccgatgtggccaggcaggactc
acacgagtggagtctgctctcgataacttcgacagggcggttatcaccaccacccatgag
ttcgcgtcccgaatgcttgtggagttgggagtgttatcagaccatgacccgtcctcagtg
ctgatgactgatcttgcccccctagcaaccgaggtatccgatgaccactacctggcacag
tatctcgactgtgaccggccgccctcagtgcgcgaaaaacgcgagctatctcgagatgtc
gcggtgaaatacggcgaggttccgatcttctccaaggaagatgcagacacgcctgtgcaa
gacgtgctgtgggccttatcagtacgagaagacgtccggagacgctccaaatcgcggtcg
gtgcatacctttgacgaccttattggcgatcttgtcaaggctcttcgtgacccataccgt
ggcccgttagcttgcgcaacgcttgctaatcggtttggactcgtcatggttgacgagttc
caagacactgatcctctgcaatgggagatactgcaacgagcctttcatggccacagcaac
ctttggctaatcggagatccaaaacaatcgatctacgccttccgaggggctgacatccac
gcttatcaagacgcggcccaatctgccagccatgtccttcatcttgacgtcaactaccga
actgataagcccattgtcgaggccgttaataccctctttagcaatgctcagttgggccac
ggtatttcaacggagttagtgacggcccatcatcaggaatcccgaattaagacagcggcc
accgatggaccgcgctaccactggtctcaacccttccagatccgctgcctccaagctcct
gccggcgcgcagctcaacacagcggcctccgatcagttcgttactgaagacctcgttaat
caggtaatcatgatgctcgagggcggaacggtcgttcaagatggcgacgggtcaaggcca
cttcgccccaacgacatcgcgatcctggtgcgaacacgtcgcaggggtgccgaacttgcg
acagcgctatcacaggtccatcagcctgcagtgttctctggtgcttcaccggtgtggtcg
tctcaggcggctgaagatcttatgaccttgctcgaggctctcgagaataccgatgaaagg
ctgcggaccaggttgtgcctgtctgacctcatcggtgcaacgccagccgatttggcagca
tccgactcgcgggtgcgctctgacctggcgattgacctggctcgctggtcgagtacctgg
acgatgacgggggtatggggaacggttgaggctgcccttcatcgccccggtgtgctggtg
cgtctggtaagcatggcaggtggtgagcgatacgtcaccgatctacgtcaggtggcacaa
aaggcgcatattgcggcctgtgaaggaagattgacggcgacggcaaccgcagcatggatc
cgcgagcaacagcaactggcaggcgacgacgaaccccgtcgccttgatagtgaccaacag
gctgtcatcatcatgaccgtccatgaggcaaagggtctgggattccccgtcgtgttattg
cctgacatcaccaatggatgggcgccgaagcagagcatcaatggtccgatcgtgtggcat
gacgggcaacggcgcgtgttggacatcagttcgcagggaaccgatcgttccatagcaatc
gagagccacgaagaggacgagcggggcgagaaccttcgcttgctgtacgtcgccctcacc
cgcgcccgatctgctgtacgactatggtggtccccttgtcctcggcgtcatcgatggtcc
gccttccaacgccttgtcgagatggaccgcacgacgggcgagctcggctcaggcgttgcc
gggaccgaccccggaactctcccctggttcaactccggaccgattgcgacagtaatagca
cctgctaaccagaaactccttacccggtcggtcagcgcccagcctcgtgcctgcgttgtc
cctaggacgctgacgcgaccactcgacaccgcgtttgcccgaacctcatattcaggactg
acggccaacctgcacgcagccgtgtcggaatctatgactaacaacctcatcgacgaaccc
gttgacgacgagtccgtcgatgacacagcccccggtctgtgtgggttacccggaggaacc
tccttcggcaccctggttcacacggtccttgagtacatcgacaccgcggctaccgacctc
tccagcgaggtactctcaatcacccgcagagcccttcgaatgtcgcccttaccagacgtc
ccaccatctgaactcgccaccagtttggagcaggttcttcatagtgatctcggacccttg
gccccgggcatgaccttggcagatttttccccggcggatcgactggctgagatgaatttc
gaacttgccatgacccagcacggacgatcgaccaccatgacagacctagcgtccctcctc
tgcgatccgagtctggtgccacccgacgatcccatcagcggctacggcgaaatattggcc
catatccccaatggcgaccaggcgctacgcggctttctcacgggttcgatcgatgctgtc
ttgaggcgacccgatggtcgtcatctagttgtcgattacaagacgaaccgaattcctgga
gtccacaagctcagtcctcatatgtatgacgcacacacgatgagggccataatgttcagt
tctcactacccgctgcaaggattgttgtattcggcagccttgcatcgattcctggcatca
agtctgcctggatacgaccccgcaacccatcttggccccattggctacctttttgttcga
ggtatggctgatcgtccagtacccgacggtgacatgcctgacggagtttttacctggcat
ccgagacctgaactcattgaggcgatcagcgagcaattgggaggtctccatgactga

DBGET integrated database retrieval system