KEGG   Gottschalkia acidurici: Curi_c05740Help
Entry
Curi_c05740       CDS       T02255                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase GpmA
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cad  Gottschalkia acidurici
Pathway
cad00860  Porphyrin and chlorophyll metabolism
cad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Curi_c05740 (gpmA)
Enzymes [BR:cad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Curi_c05740 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFS77648
UniProt: K0AUU0
Position
638822..639412
Genome map
AA seq 196 aa AA seqDB search
MKFIIARHAETEANANRIFSGWTDYPLTEKGIKQAKRLGYMLKKNYNIDKLYSSPLDRAL
KTANIVSKSIEREIIVTDNLKEVNFGIFEGKTGEEIQAEHGEHWDSWHKDYVNFRLPQGE
NLIDLLDRIRPLIDNLKQGDKDCLLVTHAAVMQVAITYLLDLDLKKMWNFQCKNCSFVEI
EYSNNFAFIKRLSPVD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttataatagcaaggcatgcagaaacagaggcaaatgcaaaccgtatatttagt
ggatggacagattatcctcttactgaaaagggaataaagcaggcaaagcgattgggatat
atgcttaaaaaaaattataacatagataaactatactcgagtccactagacagggcttta
aaaacagctaatatagtttctaagtctatagaaagagagataatagttacagataatcta
aaggaagtaaactttggaatattcgaaggaaagacaggagaggaaatacaagctgagcat
ggagaacactgggattcatggcataaagattatgttaactttagactacctcaaggagag
aatttgatagatttacttgatagaataaggccccttatagataatcttaagcaaggagat
aaagactgtctactagttactcatgcggcggttatgcaagtggcaataacatatttacta
gatctagatttaaagaagatgtggaactttcaatgtaagaattgttcatttgtagaaatc
gaatatagtaataactttgcatttataaagagactaagtccagtagattag

DBGET integrated database retrieval system