KEGG   Gottschalkia acidurici: Curi_c06730Help
Entry
Curi_c06730       CDS       T02255                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cad  Gottschalkia acidurici
Pathway
cad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01130  Biosynthesis of antibiotics
cad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Curi_c06730 (trpC)
Enzymes [BR:cad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Curi_c06730 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFS77746
UniProt: K0AZE7
Position
759755..760537
Genome map
AA seq 260 aa AA seqDB search
MFILDKIVEVKKKQLEIEKQEISLEEMIEKSKEDRIIRDFEDALDNDDISVISEIKKASP
SRGIIKEDFNPVFTAKIYEESPFNAISVLTEREFFLGDDKYINMVKEVTTKPILRKDFII
DEYQIYQSKVIGADAILLIAAILKGKLKSYYDLAKSLGLHVLVEVHGEDEIEEAIESGCR
LIGINNRNLKTFDVDLKHTEKLIKLLPSDKIVISESGIKGYEDMEYLKYLGVKGVLVGET
LMRNLSNEPKSIILGDILTP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcttagataaaatagttgaggttaaaaagaagcagctagagattgaaaagcaa
gaaattagtctagaagaaatgatagaaaaatctaaggaagatagaattataagagatttt
gaagatgcactagacaatgatgatatatcagttatatctgaaataaaaaaggcatcacct
tctagaggaataataaaagaagattttaacccagtttttacagcaaaaatatatgaagaa
agtccattcaatgctatatcagttttaacagaaagagagttttttctaggtgatgataag
tatataaatatggttaaagaagtaactactaagcctatattaagaaaagactttataata
gatgaatatcaaatatatcaatcaaaggtgataggagcagatgcaatacttttaatagca
gctatattaaaaggaaaacttaaaagctattatgatttagctaaaagtctaggacttcat
gtgttagtagaggttcatggagaagatgaaatagaagaagctatagaaagtggatgtaga
ttaataggaataaacaacagaaatctaaaaacctttgatgtagatttaaagcatactgag
aagctaataaaactactacctagtgataaaatagttatttcagaaagtggaattaagggt
tatgaggatatggaatacttaaaatacttaggagtaaaaggagtacttgtaggagaaaca
cttatgagaaatttaagtaatgaaccaaagtctataattttaggcgatatacttactcca
taa

DBGET integrated database retrieval system