KEGG   Gottschalkia acidurici: Curi_c06760Help
Entry
Curi_c06760       CDS       T02255                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cad  Gottschalkia acidurici
Pathway
cad00260  Glycine, serine and threonine metabolism
cad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01130  Biosynthesis of antibiotics
cad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Curi_c06760 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Curi_c06760 (trpA)
Enzymes [BR:cad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Curi_c06760 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AFS77749
UniProt: K0AWY5
Position
762564..763364
Genome map
AA seq 266 aa AA seqDB search
MLNRLDKRFKDLKERNEKALITFITSGVPDLETTEELVLEMEKAGADVVELGIPYSRPIA
DGKIIAEASKRALENGIKTSKVMEMVKNLREKTELPLVYLVYFNTVFAYGVDRFLSKCNE
VGIDGIIIPDLPIEERDEVLEACKENYVHLIPLVAPTSKDRIKEITEGTGGFVYCVAVNG
VTGTRDSINENIQEYMDTVSKFTDTPKAIGFGISSPEMAKEYKDYSDGVIVGSAIVRKIL
EGNSREEIVKSISSFVKELKDAVLDK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaatagattagataaaagatttaaggatttaaaggaaagaaatgaaaaagctctt
attacatttataactagtggagttccagatcttgaaactacagaagaactagttctcgaa
atggaaaaggcaggagcagatgtagtggaacttggtattccatattctcgccctatagct
gacggtaaaattatagcagaagcatctaaaagagctttagaaaacggaattaagacatct
aaagttatggaaatggtaaagaatttaagagagaaaacagaattaccactagtttaccta
gtatattttaatactgtatttgcttacggtgtagatagatttctaagtaaatgcaatgag
gtaggaatagatggaataatcatacctgatcttccgatagaagaaagggatgaagtgcta
gaagcttgtaaagaaaactatgttcacttaataccgttagtagcacctacatctaaagat
agaataaaagaaataactgaaggtacaggtggatttgtttactgtgtagcagtgaatggg
gttactggaactagagatagtataaatgaaaatattcaagaatatatggacacggtatca
aaatttacagacacaccaaaagctataggatttggtatatcaagtccagaaatggctaag
gagtataaggactactcagatggagtaatagtaggaagtgcaatagttagaaaaatacta
gagggaaatagtagagaagagatagtgaaaagtataagcagttttgtaaaagaattaaaa
gatgctgtattagataaatag

DBGET integrated database retrieval system