KEGG   Gottschalkia acidurici: Curi_c10900Help
Entry
Curi_c10900       CDS       T02255                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cad  Gottschalkia acidurici
Pathway
cad00010  Glycolysis / Gluconeogenesis
cad00051  Fructose and mannose metabolism
cad00562  Inositol phosphate metabolism
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01120  Microbial metabolism in diverse environments
cad01130  Biosynthesis of antibiotics
cad01200  Carbon metabolism
cad01230  Biosynthesis of amino acids
Module
cad_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Curi_c10900 (tpiA)
   00051 Fructose and mannose metabolism
    Curi_c10900 (tpiA)
   00562 Inositol phosphate metabolism
    Curi_c10900 (tpiA)
Enzymes [BR:cad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Curi_c10900 (tpiA)
Exosome [BR:cad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Curi_c10900 (tpiA)
  Exosomal proteins of bladder cancer cells
   Curi_c10900 (tpiA)
  Exosomal proteins of melanoma cells
   Curi_c10900 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Prenyltransf AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFS78104
UniProt: K0AY14
Position
1172054..1172800
Genome map
AA seq 248 aa AA seqDB search
MRKPFIAGNWKMHKTINESVELVREIKAKIKDSDVEVAVCVPFTSLNEVKKEIQETNIKL
GAQNMHWEESGAFTGEVSGAMLKEIGVDYVILGHSERRQYFGETDETVNKKIKKALEYNI
NPIFCVGETLEQRESGIDREIIKGQVIKGLEDISSEDLERIVIAYEPIWAIGTGKTASKE
DANSMISFIRETLKEKYDSEVSQKVRIQYGGSVKPDNVSEIMSQSDIDGALVGGASLKSD
DFLALVQF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaagccttttatcgcaggtaactggaagatgcacaagacaataaatgagtctgta
gaattagttagagaaataaaagctaaaataaaagactctgatgttgaagtagcagtttgt
gttccatttacttctttaaatgaagtgaaaaaagaaatacaagagacaaatataaagctt
ggtgctcaaaatatgcattgggaagaaagtggtgcatttacaggagaagtatcaggagct
atgttaaaggaaataggtgtagactatgttattctaggccactctgaaagaagacagtat
ttcggagaaacagatgaaacagtaaataagaaaataaaaaaagcgctagaatataatata
aatcctatattctgtgtaggagagacactagaacaaagagaatctggcattgatagagaa
ataattaaaggccaagtaataaaaggattagaagatatatctagtgaagatttagaaaga
atagttatagcttatgagccaatatgggctataggaacaggaaaaacagcgtctaaggaa
gatgcaaatagtatgatttcattcattagagaaacattaaaagaaaaatatgactcagaa
gtttctcaaaaagttagaatacaatatggtggaagtgttaagccagacaatgtaagtgaa
ataatgagtcaatcagatatagatggtgcattagtaggtggagctagcttaaagtctgat
gatttcttagcacttgttcagttttaa

DBGET integrated database retrieval system