KEGG   Gottschalkia acidurici: Curi_c16950Help
Entry
Curi_c16950       CDS       T02255                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cad  Gottschalkia acidurici
Brite
KEGG Orthology (KO) [BR:cad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cad03009]
    Curi_c16950
Enzymes [BR:cad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Curi_c16950
Ribosome biogenesis [BR:cad03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Curi_c16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Peptidase_C25
Motif
Other DBs
NCBI-ProteinID: AFS78702
UniProt: K0B0U6
Position
complement(1771135..1772043)
Genome map
AA seq 302 aa AA seqDB search
MEIIEIFVDEEDDERIDAYLTQQLNETSRAHIQRLIKDELVKVNNKNVKPRYIVRTGDHI
VVSLPQEQELEIISENIPIDMVYNDEDVAVINKPQGMVVHPAPGNYSGTLVNALLYHFRT
LSNINNKMRPGIVHRIDKDTSGLLMIAKNNFAHEDLAQQLKEHSTTRKYYALVEGNIKED
SGTINAPIGRHPIDRKKMTVTDKNSKEAITHFKVLERFEKYTLIEAQLETGRTHQIRVHM
AFINHPVVGDPVYGYKNQKFKLKGQLLHAKTLGFIHPRTKKYLEFDSEIPEYFKNIILKL
RK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggagataatagagatattcgtagatgaagaagatgatgaaaggatagatgcttattta
acccaacagttaaatgaaacgtctagagcacatatacaaaggctaataaaagatgaacta
gttaaggtaaataacaaaaatgtaaagcctagatatatagttaggacaggagatcatata
gtagtatctctcccacaagagcaagaattagaaataatttcagaaaatatacctatagac
atggtttataatgatgaagatgtggctgtaataaataaaccacagggaatggttgttcac
cctgctcctggtaactatagtgggacactagtaaatgcactattatatcactttaggaca
ttatccaatataaataacaaaatgagaccaggaatagttcataggatagataaagataca
tccggacttttgatgatagcgaaaaataactttgctcatgaagatttagcacaacagttg
aaagaacatagtactacgagaaagtactatgcactagtagaaggaaatataaaagaagat
agtggaacgataaatgcaccaataggaagacatcctattgataggaaaaaaatgacggtt
actgataaaaatagtaaagaagctataacccactttaaagttttagaaagatttgaaaaa
tacactttaatagaagcacaactagagactggaaggactcatcaaataagagttcatatg
gcatttataaatcatcctgtggtaggagatcctgtttatggatataaaaatcagaagttt
aaattaaaaggacagttattgcacgcaaaaactttaggatttattcaccctagaactaaa
aaatatttggaatttgactctgaaattccagaatattttaaaaatataatattaaaatta
agaaaataa

DBGET integrated database retrieval system