KEGG   Gottschalkia acidurici: Curi_c25440Help
Entry
Curi_c25440       CDS       T02255                                 

Definition
(GenBank) bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
cad  Gottschalkia acidurici
Pathway
cad00270  Cysteine and methionine metabolism
cad00670  One carbon pool by folate
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01120  Microbial metabolism in diverse environments
cad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Curi_c25440
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Curi_c25440
Enzymes [BR:cad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Curi_c25440
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     Curi_c25440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR Cons_hypoth95 LigA
Motif
Other DBs
NCBI-ProteinID: AFS79539
UniProt: K0B235
Position
complement(2667140..2668873)
Genome map
AA seq 577 aa AA seqDB search
MGTYYSEITGERVSFCELANINNPETIRNIHKEYIDSGAKLIRTNTFSANTITLGVTREK
LKEIIESGYNIAKESTEGRKVFVGASIGPIHESVFKKDDDIDILEEYKFIVDTFLNLGED
IFIFETFGTIDYLKEISEYIKSKNSNAFILTQFAVTLDGFTRKGISINGILDEVKKIETI
DAYGFNCGSGPSHLYKLIKDMDIFDDTISALPNASYPELINERMVYVNNPDYFANIVVDI
SKLGAKIIGGCCGTTPAHIKSIVEKLESNGFKEVEHIKVKEKHKAVFEKKRNNFLNKVED
NKFIISVELDPPYDTSIEKMVDNARICKENGVDIVTIADSPRGIARVDSIMIAAKIKREI
GIDVIPHLCCRDKNLNALKSGLLGAHIEDIRNILVVTGDPILDIDKISTKSVFNLNSYRL
MELISELNKETFKTDKINISGALNLNVKNKELEINRMLKKVEQGANIFFTQPIFHDEVID
FLSKLKKDSGIKIMGGIMPIVTYKNAQFLNNEVPGIDIPKEYVDRFHKDMTKEESEQVGI
ELATEIANKLKDHVDGFYFITPFDRIEMVMEILKKVR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggggacttactactctgaaattactggtgaaagagtatcgttctgtgaacttgcaaat
attaataatccagaaacaataagaaatattcacaaagagtatatagactcaggagctaag
ctaattagaactaatactttttccgctaatactattacactaggagttactagggaaaaa
ttaaaagaaataatagagagtggatataatatagctaaagagtctacagaaggaagaaaa
gtgtttgtaggagctagtattggtcctatacatgaatctgtatttaaaaaagatgatgat
atagatattttagaagaatataaatttatagtagatacatttttgaatctaggagaagat
atttttatatttgagaccttcggaactatagattatctaaaagagatatctgaatatata
aaatcaaaaaatagtaatgcttttatattaactcaatttgcagttacattagatggattt
actagaaaaggtataagtataaacggtatattagatgaagtgaaaaagatagaaactata
gatgcttatggattcaattgtggttcaggacctagtcatttatacaaactaataaaagat
atggatatatttgatgacactatatcagcattacctaatgcgagttacccagagcttata
aatgaaagaatggtgtatgtaaataatccagattattttgcaaatatagtagtagatatt
agtaagttaggagctaaaataataggtggatgctgtggtactacaccagctcatataaaa
agtatagtggaaaaactagaatcaaatggcttcaaagaagtggaacatataaaggttaaa
gaaaagcataaagcagtatttgaaaaaaaaagaaataattttttaaataaagtagaagac
aataagtttataatatcagtagagttagatccaccatatgatacttctatagaaaaaatg
gtggataatgctaggatatgcaaagaaaatggagtggatatagtaactatagcagactct
cctaggggaatagctagggtagactctattatgattgcagcaaagattaagcgagaaatt
gggatagatgtaatacctcatctttgttgtagagataaaaatttaaatgcattaaagtca
ggacttcttggggctcatattgaagatataagaaatatactggtagttacaggagaccct
attttagatatagataaaatatctactaaaagtgtatttaatctaaattcatatagatta
atggaacttatatctgagttaaacaaggaaacttttaaaacagataaaatcaatataagt
ggagcattaaatttaaatgttaagaataaagagttagaaataaataggatgttaaaaaag
gtggagcaaggagcaaatatattcttcactcagcctatatttcatgatgaagtaatagat
tttctatctaagcttaaaaaagacagcggaataaagataatgggtggaataatgcctata
gttacctataaaaatgctcagttcttaaataatgaggttccaggaatagatatacccaaa
gaatatgtagacagattccataaagatatgactaaagaagagtcagaacaagtgggtata
gagttagctacagaaatagctaataaattaaaggatcatgtagatggattttattttatt
acaccatttgatagaattgaaatggtgatggaaatacttaaaaaagttagataa

DBGET integrated database retrieval system