KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0097Help
Entry
SMB_G0097         CDS       T01548                                 

Gene name
cysG
Definition
(GenBank) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00860  Porphyrin and chlorophyll metabolism
cae01100  Metabolic pathways
cae01110  Biosynthesis of secondary metabolites
cae01120  Microbial metabolism in diverse environments
Module
cae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMB_G0097 (cysG)
Enzymes [BR:cae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SMB_G0097 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SMB_G0097 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEI33957
Position
105024..105671
Genome map
AA seq 215 aa AA seqDB search
MPKDIKKDISEVENLFIALVSPKLKILVIGGGNAALIKVRNFIKMGCLITIVSKEFKEEF
NMLSGFPNIKLIKGEYLRDYLKHYHIIIIATNNFKLNDKIRQDCDYINKMYMDCGEPEKG
LYIVPYQNDSKMFSLSIKSRYKSPKTSKYVLDKAMTFIKRYEDFSEYTANIRNKIKGSRK
KEIMNFVCSDDFYFFYKKRKADIVLQMFYRELNGE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaaggatattaagaaggatatttcagaagtagaaaatttatttatagcgcttgtc
tctcctaagttaaaaattctagttatagggggaggaaatgcagctcttataaaggtaaga
aactttattaaaatgggctgtttaattactatagtttcaaaggaattcaaggaagagttc
aatatgcttagtggatttcctaatataaaactgataaaaggagagtatttaagagattat
cttaagcattaccatataattataatagcaacaaataattttaagttaaatgataaaata
aggcaggattgcgattatataaataaaatgtatatggactgtggtgagcctgaaaaggga
ctatatattgtaccgtatcaaaatgattcaaaaatgttttcgctttctattaaatccaga
tataaaagtcctaaaacttcaaagtatgttttggataaagcgatgacatttattaaaaga
tatgaggatttttcagaatatacagcaaacataagaaataaaattaagggaagtagaaaa
aaagaaattatgaactttgtttgttcagatgacttttattttttttataagaaaagaaaa
gcggatatagtgcttcagatgttttatagagaattgaacggggagtga

DBGET integrated database retrieval system