KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0725Help
Entry
SMB_G0725         CDS       T01548                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00010  Glycolysis / Gluconeogenesis
cae00051  Fructose and mannose metabolism
cae00562  Inositol phosphate metabolism
cae01100  Metabolic pathways
cae01110  Biosynthesis of secondary metabolites
cae01120  Microbial metabolism in diverse environments
cae01130  Biosynthesis of antibiotics
cae01200  Carbon metabolism
cae01230  Biosynthesis of amino acids
Module
cae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cae_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMB_G0725 (tpiA)
   00051 Fructose and mannose metabolism
    SMB_G0725 (tpiA)
   00562 Inositol phosphate metabolism
    SMB_G0725 (tpiA)
Enzymes [BR:cae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMB_G0725 (tpiA)
Exosome [BR:cae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMB_G0725 (tpiA)
  Exosomal proteins of bladder cancer cells
   SMB_G0725 (tpiA)
  Exosomal proteins of melanoma cells
   SMB_G0725 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI33135
Position
823729..824475
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMNNTISESLKLIEELKPLVKDAKAEVVVAPTAVSLETVVNATKGSNIKV
AAQNAHFEESGAFTGEISLKALEELGVSYVILGHSERRQYFNETDCALNKKVKAAFAHNI
TPILCCGETLEEREANVTNEVTGKQIKLDLAGLSAEQAAKVVIAYEPIWAIGTGKTATDE
QANETIGAIRKTVEVMFGKEVAEKVRIQYGGSVKPNTIKAQMAKPEIDGALVGGASLKAA
DFAAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaataatcgccggtaattggaaaatgaataacacaattagtgaatcttta
aaattaattgaagaattaaagccacttgtaaaagatgcaaaggctgaagttgtagtagca
cctacagctgtttctttagaaactgttgttaatgctacaaaaggaagtaacattaaggtt
gctgcacaaaatgcacactttgaagaaagtggagctttcactggagaaatatcactaaaa
gcacttgaagaattaggtgtaagttatgtaatattaggtcatagtgaaagaagacagtat
tttaatgaaacagattgtgctttgaataaaaaagtaaaagcagcatttgctcataatata
actccaatattatgctgcggagaaactcttgaagaaagagaagcaaatgtaacaaatgaa
gttacaggaaagcaaataaagttagatttagcaggattaagtgctgaacaggcagctaag
gttgttatagcttatgaaccaatttgggcaataggaacaggtaaaactgctacagatgaa
caggcaaatgaaacaattggagcaatcagaaaaacagtagaagtaatgttcggaaaagaa
gttgcagaaaaagtaagaatacaatatggtggttctgtcaaaccaaatacaattaaagct
caaatggctaagccagaaatagatggagcattagttggaggagcaagccttaaagcagct
gattttgcagcaatagttaatttctaa

DBGET integrated database retrieval system