KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0954Help
Entry
SMB_G0954         CDS       T01548                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00340  Histidine metabolism
cae01100  Metabolic pathways
cae01110  Biosynthesis of secondary metabolites
cae01230  Biosynthesis of amino acids
Module
cae_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SMB_G0954 (hisD)
Enzymes [BR:cae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SMB_G0954 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEI33461
Position
1078087..1079382
Genome map
AA seq 431 aa AA seqDB search
MEDIIRIIQDGSLDGEKYFQSLKERQGKENAEIIKTVKFIIDNVKENGDKALIEYTSKFD
KVELQSIEVTKEEIKAAYSKVENDFICALKTAKENIEEYHSKQVQNSYVITKENGIVMGR
TVRGLDKVGIYVPGGTAAYPSSVIMNAVPAKVAGVNKIIMTTPPMKDGFVNPSILVAADL
AGVDKIYKVGGAQAIAALAFGTETIDKVDKIVGPGNIFVAMAKKSVYGFVDIDMIAGPSE
ILVISDETGNPKFIAADLMSQAEHDTLASSILVTTSKELIGKVIEEIKLQVEGLSRKEII
LEALRNFGAIILVDSISRAIEIGNVVAPEHLEIITPNPFEYLNDIKNAGSIFLGSYSPEP
LGDYMAGPNHVLPTSGTARFSSPLSVDDFVKKSSYLYYSEKALRNVNDKVVKIAETEGLT
AHANSIKVRFK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttggaagatattataagaataatacaagatggcagtttggatggggaaaagtactttcag
tcattaaaggagagacagggaaaagaaaatgctgagataattaaaacagtgaaattcata
atagataatgtaaaggaaaatggagataaagcacttattgaatacactagcaaatttgat
aaagtagagcttcaaagtatagaggttacaaaagaagaaataaaagctgcttacagtaaa
gtagagaatgactttatttgtgcccttaaaactgcaaaggaaaacattgaggagtatcac
tcaaaacaagttcaaaattcatatgttataactaaggaaaatggtattgtaatgggaaga
acagtaaggggacttgataaagttggtatatatgtaccaggaggaacagcggcatatcct
tcatcagttattatgaacgcagtacctgctaaggttgcaggagtaaataaaattataatg
actactccacctatgaaagacggctttgtaaatccgagcattctagttgcagcagattta
gctggagttgataagatatataaggtaggaggagctcaagcaattgcagcgcttgcattt
ggaactgagacaatagataaagtagataagattgtaggacctggaaatatatttgttgca
atggcaaagaaaagtgtatatggatttgtagatatagatatgatagcaggtccaagtgag
atacttgttatttcagatgaaacaggaaatcctaaatttatagctgcagatttaatgtca
caagcagaacacgacacacttgcctcatctattttagttacaacttcaaaagaacttata
ggtaaggttatagaagagataaaacttcaagtagagggattaagtagaaaggaaataata
cttgaagctttaaggaattttggtgccataatattggtagatagtataagtagagccata
gaaataggaaatgttgtagctccagaacatcttgaaatcataacgcctaatccctttgaa
tatttgaatgatataaaaaatgcaggctcaatatttttaggaagctattctccagaaccc
ttaggggattatatggcaggacctaatcatgtgcttcctacaagtggaacagctagattc
tcttctccactttcggtagatgattttgttaagaagtcaagttatttatattattcagaa
aaggctcttagaaatgtgaatgataaggtagttaagattgctgaaacagaaggacttaca
gcacacgctaattcaattaaagtaagatttaaataa

DBGET integrated database retrieval system