KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2689Help
Entry
SMB_G2689         CDS       T01548                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00240  Pyrimidine metabolism
cae00250  Alanine, aspartate and glutamate metabolism
cae01100  Metabolic pathways
Module
cae_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SMB_G2689 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMB_G2689 (pyrB)
Enzymes [BR:cae01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SMB_G2689 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEI33442
Position
complement(2768141..2769064)
Genome map
AA seq 307 aa AA seqDB search
MLKGRSLIDPMDFTVDELEEIFKLADDIIACPKEYMHAAEGKILATLFYEPSTRTRFSFE
TAMLRLGGQVVGFSEPNSSSVSKGETIADTIRVVSCYADIAAMRHPKEGAPKVASMYSSI
PVINAGDGGHQHPTQTLTDLLTMRRTKKRLSNLTIGMCGDLKFGRTVHSLIKAMSRYDNN
KIVLISPDELKVPEYIKKEILDKNNIEYKEAKRIEDVIEELDVLYMTRVQKERFFNEEDY
IRLKDSYILNENKLKTAKKDMIILHPLPRVNEISYEVDNDERAYYFKQAKNGMYVRMALM
AKLMGVL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggtagaagtttaattgatcctatggatttcactgtagatgagctggaagaa
atatttaaacttgcagacgatataatagcgtgtcctaaggaatatatgcatgcagcagaa
ggtaaaatacttgccactttattttatgaacctagtacaaggactagatttagttttgaa
acagcaatgttaagacttggaggtcaggttgttggtttttctgagccgaactcaagttcc
gtgtcaaaaggagaaactattgcagatactataagagtagtttcttgttatgcagatatt
gcagcgatgaggcatcctaaagaaggtgctccaaaggtcgcttccatgtattcatcaatt
ccagtaataaatgcgggagatggcggacatcaacatccgactcaaaccctaacagatcta
ttaacaatgagaagaacaaaaaagagactttcaaatttgaccataggtatgtgtggagat
ttaaaatttggaagaacggtccattctttaataaaagcaatgtccagatatgataataat
aaaatagtattgatttctcctgatgagcttaaagttccagaatacataaaaaaagagata
ctcgataagaacaatatagaatataaagaggctaaaagaatcgaggatgttattgaagaa
ttagatgtgctctatatgacaagagtacaaaaggaaagattttttaatgaggaagattat
ataaggcttaaagatagctatatacttaacgaaaataaattaaaaactgcaaaaaaagat
atgataatacttcatccgcttcctagagtcaatgaaatttcatatgaagtagataatgat
gaaagggcatactattttaaacaggcaaagaacggaatgtatgtcagaatggctcttatg
gcaaaattaatgggggtgttataa

DBGET integrated database retrieval system