KEGG   Clostridium acetobutylicum DSM 1731: SMB_P077Help
Entry
SMB_P077          CDS       T01548                                 

Gene name
thil
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00071  Fatty acid degradation
cae00072  Synthesis and degradation of ketone bodies
cae00280  Valine, leucine and isoleucine degradation
cae00310  Lysine degradation
cae00362  Benzoate degradation
cae00620  Pyruvate metabolism
cae00630  Glyoxylate and dicarboxylate metabolism
cae00640  Propanoate metabolism
cae00650  Butanoate metabolism
cae00900  Terpenoid backbone biosynthesis
cae01100  Metabolic pathways
cae01110  Biosynthesis of secondary metabolites
cae01120  Microbial metabolism in diverse environments
cae01130  Biosynthesis of antibiotics
cae01200  Carbon metabolism
cae01212  Fatty acid metabolism
cae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMB_P077 (thil)
   00630 Glyoxylate and dicarboxylate metabolism
    SMB_P077 (thil)
   00640 Propanoate metabolism
    SMB_P077 (thil)
   00650 Butanoate metabolism
    SMB_P077 (thil)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMB_P077 (thil)
   00072 Synthesis and degradation of ketone bodies
    SMB_P077 (thil)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMB_P077 (thil)
   00310 Lysine degradation
    SMB_P077 (thil)
   00380 Tryptophan metabolism
    SMB_P077 (thil)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMB_P077 (thil)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMB_P077 (thil)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMB_P077 (thil)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cae04147]
    SMB_P077 (thil)
Enzymes [BR:cae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMB_P077 (thil)
Exosome [BR:cae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMB_P077 (thil)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEI34820
Position
pSMBa:complement(82040..83218)
Genome map
AA seq 392 aa AA seqDB search
MRDVVIVSAVRTAIGAYGKTLKDVPATELGAIVIKEAVRRANINPNEINEVIFGNVLQAG
LGQNPARQAAVKAGLPLETPAFTINKVCGSGLRSISLAAQIIKAGDADTIVVGGMENMSR
SPYLINNQRWGQRMGDSELVDEMIKDGLWDAFNGYHMGVTAENIAEQWNITREEQDEFSL
MSQQKAEKAIKNGEFKDEIVPVLIKTKKGEIVFDQDEFPRFGNTIEALRKLKPIFKENGT
VTAGNASGLNDGAAALVIMSADKANALGIKPLAKITSYGSYGVDPSIMGYGAFYATKAAL
DKINLKPEDLDLIEANEAYASQSIAVTRDLNLDMSKVNVNGGAIALGHPIGASGARILVT
LLYAMQKRDSKKGLATLCIGGGQGTALVVERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgtagtaatagtaagtgctgtaagaactgcaataggagcatatggaaaaaca
ttaaaggatgtacctgcaacagagttaggagctatagtaataaaggaagctgtaagaaga
gctaatataaatccaaatgagattaatgaagttatttttggaaatgtacttcaagctgga
ttaggccaaaacccagcaagacaagcagcagtaaaagcaggattacctttagaaacacct
gcgtttacaatcaataaggtttgtggttcaggtttaagatctataagtttagcagctcaa
attataaaagctggagatgctgataccattgtagtaggtggtatggaaaatatgtctaga
tcaccatatttgattaacaatcagagatggggtcaaagaatgggagatagtgaattagtt
gatgaaatgataaaggatggtttgtgggatgcatttaatggatatcatatgggagtaact
gcagaaaatattgcagaacaatggaatataacaagagaagagcaagatgaattttcactt
atgtcacaacaaaaagctgaaaaagccattaaaaatggagaatttaaggatgaaatagtt
cctgtattaataaagactaaaaaaggtgaaatagtctttgatcaagatgaatttcctaga
ttcggaaacactattgaagcattaagaaaacttaaacctattttcaaggaaaatggtact
gttacagcaggtaatgcatccggattaaatgatggagctgcagcactagtaataatgagc
gctgataaagctaacgctctcggaataaaaccacttgctaagattacttcttacggatca
tatggggtagatccatcaataatgggatatggagctttttatgcaactaaagctgcctta
gataaaattaatttaaaacctgaagacttagatttaattgaagctaacgaggcatatgct
tctcaaagtatagcagtaactagagatttaaatttagatatgagtaaagttaatgttaat
ggtggagctatagcacttggacatccaataggtgcatctggtgcacgtattttagtaaca
ttactatacgctatgcaaaaaagagattcaaaaaaaggtcttgctactctatgtattggt
ggaggtcagggaacagctctcgtagttgaaagagactaa

DBGET integrated database retrieval system