KEGG   Collinsella aerofaciens: CSV91_01705Help
Entry
CSV91_01705       CDS       T05143                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
caer  Collinsella aerofaciens
Pathway
caer00230  Purine metabolism
caer00240  Pyrimidine metabolism
caer01100  Metabolic pathways
caer01110  Biosynthesis of secondary metabolites
caer01130  Biosynthesis of antibiotics
Module
caer_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
caer_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
caer_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:caer00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CSV91_01705
   00240 Pyrimidine metabolism
    CSV91_01705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:caer04131]
    CSV91_01705
Enzymes [BR:caer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CSV91_01705
Membrane trafficking [BR:caer04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CSV91_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ATP53367
UniProt: A0A2D1TVI4
Position
378764..379168
Genome map
AA seq 134 aa AA seqDB search
MAIEKTFIMIKPDAVRDRKIGEIVARIERSGLVIERMEMTTLERATVEEHYAHLADKPFF
GGLCDFMTSGPVVKMVVSGLSAVSKMRTLMGATNPLDAAPGTIRGDFAVDVNANVIHGSD
CLENAEIEIKRFFG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagaagaccttcatcatgattaagcccgacgctgtgcgcgaccgcaagatc
ggcgagatcgttgctcgtatcgagcgcagcggccttgtcatcgagcgcatggagatgacc
acgcttgagcgcgccaccgtcgaggagcactacgcccatctggccgacaaacccttcttt
ggcggtctgtgcgactttatgacgagcggtccggtcgtcaagatggttgtttccggtctt
tccgccgtctccaagatgcgcacccttatgggcgccaccaacccgcttgatgccgctcct
ggcaccattcgcggcgactttgccgtcgatgtcaacgccaacgtgattcatggctccgac
tgcctggagaacgccgagatcgagatcaagcgtttctttggctaa

DBGET integrated database retrieval system