KEGG   Collinsella aerofaciens: CSV91_02705Help
Entry
CSV91_02705       CDS       T05143                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
caer  Collinsella aerofaciens
Pathway
caer00860  Porphyrin and chlorophyll metabolism
caer01100  Metabolic pathways
Module
caer_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:caer00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CSV91_02705
Enzymes [BR:caer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CSV91_02705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ATP53543
UniProt: A0A2D1TVZ7
Position
615666..617198
Genome map
AA seq 510 aa AA seqDB search
MAEARRRRSIPVGRAKPIMIQGTMSNAGKSLLAAGLCRVLLQDGLRVTPFKSQNMALNSG
VTADGLEMGRAQIMQAEACGIAPDVRMNPILLKPESDHRSQLIVAGKAQGAFAARDYFAR
KKALMPQILEAFDSLAEENDVIVIEGAGSPAEINLSENDIVNMGLARAVSSPVLLVGDID
PGGVFAQLYGTVALFAPEDRALLRGLLVNKFRGDVEILRPGLAPLEKMCGVPVVGVVPYL
TLDLDDEDSLAPRLSAREARGVIDVAVVRLPHLSNFTDFDPLSRVPGMGVRYVSSTTDLG
RPDLVVLPGSKATLDDARWLAASGIGACVRALSGAGTPVLGICGGYQLLGDELSDPHGRE
GAGTARGLGLIPASTVFKEEKRLAQSELRITGAQGAFSVWNGMTARGYEIHDGETTVSCA
PAGTIGGKPEGAACGNVFGTYLHGLFDEPGVALALARSLARMRGLPESVVGAAGAASAAD
HRAREFDRLADVVRGALDMEYFYRIIEEGV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctcggcgaaggaggtcgatacccgtgggtagggcgaagcccatcatgatc
cagggcaccatgtcgaacgcggggaagagcctgcttgcggctgggctgtgccgtgtgctt
ttgcaggacggcctgcgcgtgactcccttcaagagccagaacatggcgctcaacagcggt
gtcacggccgacgggctcgagatggggcgcgcccagatcatgcaggccgaggcgtgcggc
atcgcgcccgacgtgcgcatgaaccccatcctgctcaagcccgaaagcgaccaccgaagc
cagctcatcgtggccggcaaggcgcagggagccttcgctgcgagggactacttcgcgcga
aagaaggcgctcatgccgcagattttggaggcgttcgattcgctcgcggaggaaaacgac
gtcatcgtcatcgagggcgccggcagccccgccgaaatcaacctttccgaaaacgacatc
gtcaacatggggctcgcgcgcgccgtgtcctcccccgtgctgctcgtgggcgacatcgac
ccaggcggggtgtttgcccagctctacggcacggtcgcgctctttgcgcccgaggatcgc
gcgcttttgcgggggcttttggtgaacaagttccgcggcgatgtggaaatcctgcgcccg
ggtttggccccgctcgagaagatgtgcggggttcccgtcgtgggggtcgtgccgtatctt
acgctcgacctggacgacgaggactcgctcgcgccgcgcctatctgcccgcgaggcgcgc
ggtgtcatcgacgtcgccgtcgtgcgccttccgcatctgtcgaacttcaccgacttcgac
ccgctttcgcgcgtgcctggcatgggcgtgcgctacgtttcctcgacgaccgatctgggc
cgacccgacctggtggtgcttcccggctcgaaggccacgctcgacgacgcgcgctggctt
gcggctagcggcatcggagcctgtgtacgcgcgctttcgggcgcgggtacgccggtgctc
ggcatatgcggaggctaccagcttttgggagacgagctttccgacccgcacggcagggaa
ggcgctggcaccgcgcgcgggctcgggctcatccctgcaagtacggtgttcaaggaggaa
aagcgcctcgcccagtcggagctgcgcatcacgggcgcccaaggcgcgttctcggtgtgg
aacggcatgacggcgcgcgggtacgagattcacgacggcgaaacgaccgtctcctgcgcc
cctgcgggtacgattggcggcaaaccagaaggcgcggcctgcggaaacgtgttcggaacc
tatctccacggtctgttcgacgaaccgggggtggcgctcgccctcgcgcgctcgctcgcg
cgcatgcgcggcctgcccgagagcgtcgtgggtgctgcgggcgcagcgtccgcggccgat
caccgtgcgcgcgagttcgaccgcctggccgacgtcgtgcgcggggcactcgacatggag
tatttctaccgcattatcgaggagggcgtatga

DBGET integrated database retrieval system