KEGG   Collinsella aerofaciens: CSV91_08860Help
Entry
CSV91_08860       CDS       T05143                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
caer  Collinsella aerofaciens
Pathway
caer00270  Cysteine and methionine metabolism
caer00920  Sulfur metabolism
caer01100  Metabolic pathways
caer01110  Biosynthesis of secondary metabolites
caer01130  Biosynthesis of antibiotics
caer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:caer00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CSV91_08860
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CSV91_08860
Enzymes [BR:caer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CSV91_08860
    2.3.1.46  homoserine O-succinyltransferase
     CSV91_08860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ATP54631
UniProt: A0A2D1TZ56
Position
2045960..2046886
Genome map
AA seq 308 aa AA seqDB search
MPIRIPDALPAAAQLESENIFVMTEYRALHQDIRPLRVLILNLMPTKIATETQIMRKLSN
TPLQVEVDLLRTKTHEATHVSAGHLETFYRTFDDIRDIHYDGLIITGAPVEQMPFEEVDY
WPELCQIMDWSTTHVHSTLHICWGAQAGLYHHYGIQKHDLPAKASGVFEHHLVKPQSPLV
RGFDDRFYAVHSRNTDVRREDVEAEPQLEVVAVSDEVGLYIVKSTDSRRFFVFGHPEYDT
DTLRLEYERDVKRGLNPEVPAHYFPGDDPTAEPRNVWRSQAQLLYTNWLNYYVYQTTPYD
LARAGEEH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccattcgtattcccgacgcccttcctgccgcagcgcagcttgagagcgagaacatc
tttgtcatgaccgagtaccgcgcgctgcaccaggacatccgtcctctgcgcgtgctcatc
ctcaacctcatgcccaccaagatcgccaccgagacgcagatcatgcgcaagctctccaac
acgccgctacaggtggaggtggacctgctgcgcaccaagacgcacgaggccacgcacgtg
agcgctggccacctggagacgttctaccgcacgttcgacgacatccgcgacatccactac
gacggcctgatcatcacgggcgcgccggtggaacagatgccgttcgaggaggtcgactac
tggcccgagctctgccagattatggattggtccaccacgcacgtgcactctacgctgcac
atttgttggggcgcgcaggcgggcctgtatcaccactacggtatccagaagcacgacctg
ccggcaaaggcgagcggcgtgttcgagcatcatctggtgaagccgcaaagcccgctggtg
cgcggcttcgacgaccgcttctatgccgtgcattcgcgcaacaccgatgtgcgccgcgag
gacgtggaggccgagccgcagcttgaggtcgtggccgtgtctgacgaggtgggcctgtac
atcgtcaagtcgaccgatagccgccgcttctttgtctttggccatcccgagtacgatacc
gacacgctgcgtctggagtacgagcgcgatgtgaagcgcggactcaacccggaggtgccg
gcgcattacttcccaggtgacgaccccaccgccgagccgcgcaacgtctggcgcagccag
gctcagctgctctacaccaattggctcaactactacgtctaccagaccacgccctacgat
ctagcccgcgccggcgaggagcactag

DBGET integrated database retrieval system