KEGG   Collinsella aerofaciens: CSV91_09720Help
Entry
CSV91_09720       CDS       T05143                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
caer  Collinsella aerofaciens
Pathway
caer00561  Glycerolipid metabolism
caer00640  Propanoate metabolism
caer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSV91_09720 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CSV91_09720 (gldA)
Enzymes [BR:caer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CSV91_09720 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ATP54780
UniProt: A0A2D1TZK7
Position
2254866..2255966
Genome map
AA seq 366 aa AA seqDB search
MAAIFNSPSKYIQGPDELAKLGSYVEPLGAKALVIVTPSGKKRVGAKIEGGFAEAKAELL
FEDFNGECSKGEVDRLVALARDNGCDIIVGVGGGKILDTAKAVAYYLESPVIICPTIAST
DAPCSALSVLYTDDGQFDKYLFLKANPNIVLMDTTVIAASPVRLTVSGMGDALATYFEAQ
ATHDADGGTCAGGKGGMAGLALAKLCYETLMADGVKAKVALEKGALTPAVEHIIEANTLL
SGIGFESSGLAAAHAIHNGLTMLPECHGMYHGEKVAFGTIVQLVLEDAPTEKLEEVLGFC
IELGLPVTMKELGVAEVTREQAMVVAEAACAPEDTMCNMPFEVTPEMVANAILGADALGH
YYLMDE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaattttcaatagccccagcaagtacatccagggtccggacgagctcgccaag
ctcggctcctatgtcgagccgctcggcgctaaggccctcgtcatcgtgacgccttcgggc
aagaagcgcgtcggtgccaagatcgagggcggctttgccgaggctaaggccgagctgctg
tttgaggactttaacggcgagtgctccaagggcgaggttgatcgcctggttgcgctcgct
cgcgacaacggttgcgacatcatcgtcggcgtcggtggcggcaagatcctcgacaccgcg
aaggccgtcgcctattacctggagtccccggttatcatttgccccaccattgcttcgacc
gatgccccgtgttcggcgctttcggtgctctacaccgacgatggccagttcgataaatat
ctcttccttaaggcaaaccccaacattgtcctgatggatacgacggttattgcggcgagc
ccggtgcgcctgacggtttccggtatgggcgatgcgctcgcaacctactttgaggctcag
gcaacgcacgatgccgacggtggcacctgcgctggtggcaagggcggcatggccggtctg
gcgctcgccaagctctgctacgagacgcttatggccgatggcgtcaaggccaaggtcgcg
ctggagaagggtgcgctcacgcctgcagtcgagcatatcatcgaggccaatacgctgctt
tcgggcattggctttgagagctcgggccttgctgctgctcatgccatccacaatggcctg
acgatgctgcccgagtgccacggcatgtatcacggcgagaaggtcgcctttggcaccatc
gtccagctggtactcgaggatgctccgactgagaaactcgaggaagttttgggcttctgc
attgagctgggcctgccggtcacgatgaaggagcttggtgttgccgaggttacgcgcgag
caggccatggtcgttgccgaggccgcttgcgcgcccgaggacaccatgtgcaacatgccg
tttgaggtgacgcccgagatggtcgcaaacgccatcctgggtgccgacgcgctgggccac
tactatctcatggatgagtaa

DBGET integrated database retrieval system