KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_01255Help
Entry
AL524_01255       CDS       T04738                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00071  Fatty acid degradation
caf00072  Synthesis and degradation of ketone bodies
caf00280  Valine, leucine and isoleucine degradation
caf00310  Lysine degradation
caf00362  Benzoate degradation
caf00380  Tryptophan metabolism
caf00620  Pyruvate metabolism
caf00630  Glyoxylate and dicarboxylate metabolism
caf00640  Propanoate metabolism
caf00650  Butanoate metabolism
caf00900  Terpenoid backbone biosynthesis
caf01100  Metabolic pathways
caf01110  Biosynthesis of secondary metabolites
caf01120  Microbial metabolism in diverse environments
caf01130  Biosynthesis of antibiotics
caf01200  Carbon metabolism
caf01212  Fatty acid metabolism
caf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL524_01255
   00630 Glyoxylate and dicarboxylate metabolism
    AL524_01255
   00640 Propanoate metabolism
    AL524_01255
   00650 Butanoate metabolism
    AL524_01255
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL524_01255
   00072 Synthesis and degradation of ketone bodies
    AL524_01255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL524_01255
   00310 Lysine degradation
    AL524_01255
   00380 Tryptophan metabolism
    AL524_01255
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL524_01255
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL524_01255
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL524_01255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caf04147]
    AL524_01255
Enzymes [BR:caf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL524_01255
Exosome [BR:caf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL524_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMG51828
Position
175914..177092
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVSAKRTPIGKFAGSLADVPAVMLGATCVRANLLDLPSDININEVILGNVLQAG
LGQNPAHQVTHHAGLAESVPSFTVNKVCGSGLETVVLGAQSILSGDNQTCIVGGMENMSA
APYLLARARQGYRMGNGELTDVMIHDGLWCAFNDYHMGVTAENIARRYHLSREEQDQVAL
ASQQKAIAAINAGYFRQEIVPVPLKRKKEVCLFDTDEFPRPETDASSLAKLRPAFESTGT
VTAGNASGINDAAATLVLMSERAARAHGITPLARLKSWASAGVDASMMGLGPIPATKRAL
EKAKMTVSDLDLIEANEAFAAQYLAVARELNFPEEKVNVNGGAIALGHPIGASGARILVT
LVHALQQRNKTTGLATLCIGGGQGIAVIVERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcgattgtgattgtgagtgcgaaacgcacccctatcggtaaatttgctggc
agcctggctgacgtcccggcggtaatgctgggcgcgacctgtgtccgggcaaacctgctg
gaccttccgtcagatattaacattaacgaagtgatcctcggcaacgtgttgcaggccgga
ttagggcaaaacccggctcaccaggtgacgcatcacgcaggcctggcggagagcgttccg
tcattcacggtcaataaagtctgcggttctggcctggaaaccgttgtgctaggcgcgcag
tccattctgagtggtgataatcagacctgtattgtcggcgggatggaaaacatgagcgcc
gccccctacctgctggcccgtgcgcgccagggataccgtatgggcaacggtgagctgaca
gacgtgatgatccacgacggtctctggtgcgccttcaatgattaccacatgggggtcaca
gcagaaaacattgccaggcgctatcatttaagccgtgaagagcaggaccaggtagcgctg
gcatcgcagcaaaaagcgatagccgcgattaacgccggttatttcagacaggaaatcgta
ccggtgcccctgaagcgtaaaaaagaggtctgcctgtttgataccgatgagtttccacgt
ccggagaccgatgccagttcgctggcgaaactgcgtccggcctttgaaagtacggggaca
gtcactgcaggcaatgcctccggcatcaatgatgcggcggcgacgctggtcctgatgtca
gaacgcgctgcgcgtgcgcatgggattacgccgttggcgcgcctgaagagctgggcttcg
gctggggtggatgccagtatgatgggacttgggccaattccagcgacaaaaagggcgctg
gaaaaagccaaaatgaccgtcagcgatctggatttaatcgaagccaacgaagcctttgcc
gcacagtatctggcggttgctcgcgaactcaatttcccggaagagaaagtgaacgtcaat
ggcggcgcgatcgcgctggggcatccaattggcgcaagcggcgcacggattctggtaacg
ctggttcacgcgttgcagcagcgcaataaaaccaccgggctggcaacgctgtgtatcggc
ggtggtcaggggatcgccgtgattgttgaacgtctgtaa

DBGET integrated database retrieval system