KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_04805Help
Entry
AL524_04805       CDS       T04738                                 

Definition
(GenBank) two-component system sensor histidine kinase ZraS
  KO
K07709  two-component system, NtrC family, sensor histidine kinase HydH [EC:2.7.13.3]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:caf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL524_04805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:caf01001]
    AL524_04805
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:caf02022]
    AL524_04805
Enzymes [BR:caf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AL524_04805
Protein kinases [BR:caf01001]
 Histidine kinases
  NtrC family
   AL524_04805
Two-component system [BR:caf02022]
 NtrC family
  HydH-HydG (metal tolerance)
   AL524_04805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA sCache_3_2 HATPase_c_2 HATPase_c_5 TssO Pox_A14 HATPase_c_3 dCache_1 HPTransfase
Motif
Other DBs
NCBI-ProteinID: AMG55957
Position
957774..959180
Genome map
AA seq 468 aa AA seqDB search
MRMMREHKDTVARWLSGVLPAIILILVGLFAVMVIRDYGRESDAARQTLLEKGSVLIRAL
ESGTRVGMGMRMHHAQQQTLLEEMAGQPGVLWFAVTDAQGNVVMHSDPALVGKTLYSPAE
MHTLHPGEEARWRALDATDAQGQTVPALEIYRQFQPLFFPGRHGMHGMSRGNGAMPGSAH
QFIFIAFDASELAMTQAREWRNTLIMLFALTTVLLATLLTFFWYRRYLRSRQLLQDEMNR
KEKLVAIGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHELAQVMAKEADRLNRVV
SELLELVKPAHLSLQSVDLNAVIDHSLQLVSQDAQSRAIELQFVSDPALPPVQADPDRLT
QVLLNLYLNAIHAIDRQGTIRVEASTSGADRVKITVADSGKGIAAEQLAAIFTPYFTTKA
DGTGLGLAVVQNIIEQHGGTIQADSLPGKGATFTLWLPVTLTRKDSQG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgatgcgagaacataaggatacggtagcccgatggttgagcggggtgctaccc
gccatcatcctgattctggttgggctatttgccgtgatggtgatccgcgattacgggcgt
gaaagtgacgcagcgcggcagacgctgctggaaaaaggcagtgtgctaatccgtgcactg
gagtcggggacgcgcgtcgggatgggcatgcggatgcatcatgctcagcagcaaacgctg
ctcgaagagatggcggggcagccaggcgtgctgtggtttgccgtgaccgatgcgcagggc
aacgttgtcatgcacagcgatcctgccctggtcgggaaaacgctctactcgccagcagag
atgcacacattacacccaggagaagaggcgcgctggcgtgcgcttgacgcgacggatgcg
caggggcagaccgttccggcgctggagatctatcgtcagttccagccgctgtttttccct
ggacgacacgggatgcacgggatgtcgcgtggcaatggcgcaatgccgggttctgctcat
cagttcatttttatcgcctttgatgccagtgagttggccatgacgcaggcgcgtgagtgg
cgtaatacgctgattatgcttttcgcgctgaccaccgtgctgttggcgactctcctgacg
tttttctggtaccggcgatacctgcgttctcgccagctattgcaggatgagatgaaccgt
aaagagaagctggtggcgatcgggcatctggccgcaggcgtcgcgcatgagattcgaaat
ccgctctcttccatcaaaggactggcaaagtactttgctgaacgcgcgccagcgggcggt
gaagcgcatgaactggcgcaggtgatggcgaaagaggccgatcgtttaaaccgggtggtc
agtgaactgctggaactggtgaagcccgcgcacttgtccttgcagtcggtggatctcaat
gcggtaattgaccactctctgcaactggtcagccaggacgcgcagagtcgggcgattgag
ctgcaatttgtgtctgaccctgcgctgccgcccgttcaggctgacccggaccggctgacg
caggtgttgctgaatctttatctgaacgcgattcatgccatcgatcggcaggggaccatc
cgcgttgaggcaagcacaagcggagccgatcgcgttaaaatcaccgttgcagacagcggg
aaagggattgcggcggaacagctggccgccattttcaccccttatttcacgacgaaagcg
gacggtacgggactggggctggcggtggtacagaacatcattgaacagcatggcgggacg
atccaggcggatagcctgccaggtaaaggcgcaacgttcaccctctggctcccggtgacg
ttaacacgtaaggattcacaaggatga

DBGET integrated database retrieval system