KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_07180
Entry
AL524_07180       CDS       T04738                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00230  Purine metabolism
caf01100  Metabolic pathways
caf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AL524_07180
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AMG52887
UniProt: A0A0X8S2D3
Position
complement(1476941..1477420)
AA seq 159 aa
MNDTNRITLECVINDHPFQLSIMPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAAGKQIRTLEGESAGSQLSRVQMAYATSGAVQCGFCTPGLIMATTALLAK
PREKPLTILEIRRGLAGNLCRCTGYQMIVDTVQRCTEPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatgacactaaccgaatcacgctggaatgcgtcattaatgatcacccttttcagctc
agcatcatgccggggatgccgctctctgaactcctgcgcgaacaagggttgttgagcgtc
aaacagggatgctgtgtcggtgaatgcggagcctgtacggtgctggttgacggtacggcc
atcgacagttgcctgtaccttgccgcgtgggcagcaggaaaacagatccgtaccctggaa
ggtgaatcggctggcagtcagctctcgcgtgttcagatggcttatgcgacatccggtgcc
gtgcagtgtggtttttgcacgccgggtctgattatggcgaccaccgcattgctggcaaaa
ccgcgtgaaaaaccattaaccattctggagatccgtcgtggtctggcggggaatttgtgc
cgttgtactggctatcagatgattgtcgataccgtccagcgctgcactgagcctgaataa

DBGET integrated database retrieval system