KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_07190
Entry
AL524_07190       CDS       T04738                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00230  Purine metabolism
caf01100  Metabolic pathways
caf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AL524_07190
Enzymes [BR:caf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AL524_07190
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AMG52889
Position
complement(1478306..1480603)
AA seq 765 aa
MDAREATATGESCMRVDAIAKVTGRARYTDDYMMAGMCYAKYVRSPIAHGYATSINCDEA
KSLPGVLAVFTWEDVPDIPFATAGHAWTLDENKRDTADRFLLTRHVRHHGDAVAIVVARD
ALTAEKAALLVNVEWEKLPVITTPEAALADDAVSIHPGGNLLNRSEMTTGNVQQTIDAAD
YQLQGHYQTPVIQHCHMESVTSLAWMEDDSRISIVSSTQIPHIVRRVVGQALGIPWSCVR
VIKPYVGGGFGNKQDVLEEPMAAFLTRKLGGIPVKVSLSREECFLASRTRHAFTMDGQIG
LNRDGTLQGYRLDVLSNTGAYASHGHSIASAGGNKVAYLYPRSAYAYRSTTCYTNLPSAG
AMRGYGAPQVIFAVESMLDDAATALGLDPVEVRLRNAACEGDTNPITGKRIYSAGLPECL
QKGRALFEWDARRAECLHQQGNIRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETLGVPVSDVHVISTQDTDITPFDPGAFASRQSYVTAPAL
RKAALQLRDKILLHAADMLHQSVMSLTLTAGHIVLIDRPDSPLLSLKELAMDAFYHPERG
GQLSAECSVKTTTNPPAFGCTFVDLSVDIALCKVTINRILNVHDSGHILNPQLAEGQVHG
GMGMGIGWSLFEEMIIDGESGLVRNPNLLDYKMPTMPDLPQLESAFVETQEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAIDTLPLTPKRLYAEFHQAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatgcgcgggaagcaaccgctaccggagagtcatgcatgcgcgtggatgccatcgct
aaagtgaccgggcgggctcgatatactgatgattacatgatggcgggcatgtgttatgcc
aaatacgttcgcagtccgattgcccacggttacgccaccagcatcaactgtgatgaggcg
aaaagcctgcccggtgtactggccgtgtttacctgggaagatgtaccggatattcccttc
gccacggcagggcacgcctggacgctggatgagaacaaacgtgacaccgccgaccgtttt
ctgttgacccgccacgtacgccatcatggcgatgcggtcgcgattgttgtggcaagggac
gcgttaaccgcagagaaagcggccttactggtgaatgtggaatgggaaaaactcccggtg
atcaccacgccagaagcagctctggcggatgatgctgtctctattcacccaggcggtaat
ttgctcaatcgcagtgaaatgaccaccgggaatgtccagcagaccattgatgccgctgat
taccaactccagggacattaccagacgccggtgattcaacattgccatatggaaagcgtc
acttcattggcctggatggaagatgactcgcgaatctccatcgtctccagcacgcagatc
ccacacatcgtacgccgggtcgtgggccaggcattgggcattccgtggtcatgcgtgcgg
gttatcaaaccttacgtcggcggcggatttggaaacaagcaggatgtgctggaagaaccc
atggccgctttcctgacgcgcaaactgggcggtattccagtgaaagtctctctcagccgt
gaagaatgttttctcgcttcccgtacccgccatgcgttcacgatggatggacagataggg
ctcaatcgcgacggcacgttgcaaggctatcgtctggatgttctgtcaaatactggcgct
tacgcctcacacgggcactccatcgcctcggcgggcggcaacaaagtggcctatctctat
ccccgtagcgcatacgcttaccgttccaccacctgctataccaatcttccttccgctggc
gcgatgcgcggctacggcgcgccgcaggtgatctttgccgtagaatcgatgctggatgac
gccgcaacggcgctgggtctcgatccggtcgaggttcggttgcgcaatgcggcctgcgaa
ggcgacacgaacccgattaccggcaaacgcatctacagcgcggggctcccggaatgcctg
caaaaaggccgcgcgctgtttgagtgggacgcccgtcgcgctgaatgtctgcaccagcaa
ggcaacatccgccggggcgtcggcgtcgcctgttttagttatacctccaacacctggccg
gtcggcgtggagatcgctggtgcccgtctgctgatgaatcaggacggaacgatcaacgtg
cagagcggagccacggaaatcggtcagggggcggataccgttttctcacagatggtggcg
gaaactctcggcgtaccggtcagcgatgtgcacgttatttccacccaggataccgacatt
acccccttcgaccctggcgccttcgcctctcgccaaagctatgtcaccgcaccggcactg
cgcaaggcagcacttcaactgcgcgataagatccttcttcacgctgccgacatgctgcat
cagtccgtcatgagcctgacgctgacggcaggccacatcgtccttatcgatcgcccggac
tcaccgttactgtccttaaaagagctggcgatggatgcgttttatcatccggagcgcggc
ggtcagttgtctgcggaatgctcggtgaaaaccaccactaacccaccggcgtttggctgc
acgtttgtcgatctgagcgtcgatatcgccctgtgcaaggtcaccatcaaccgcatcctc
aatgtccacgattccggccatattctgaaccctcaactggcggaaggtcaggtgcatggc
gggatgggaatgggcattggctggtcgctgtttgaagagatgatcatcgatggggaaagt
ggtctggtgcgtaacccgaatctccttgattacaaaatgccgaccatgcctgacctgccg
caactggagagcgcattcgttgaaacgcaggagccgcagtcggcgtatggacataaatcc
ctcggcgagccgcccattattcctgttgctgccgccattcgtaacgcagtgaaaatggcc
acaggcgttgcaattgatacgttgccactgacgccaaaacggttatatgcggagttccac
caggctggcttgatttga

DBGET integrated database retrieval system