KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_10640Help
Entry
AL524_10640       CDS       T04738                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00430  Taurine and hypotaurine metabolism
caf00620  Pyruvate metabolism
caf00640  Propanoate metabolism
caf00680  Methane metabolism
caf01100  Metabolic pathways
caf01120  Microbial metabolism in diverse environments
caf01200  Carbon metabolism
Module
caf_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL524_10640
   00640 Propanoate metabolism
    AL524_10640
  09102 Energy metabolism
   00680 Methane metabolism
    AL524_10640
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AL524_10640
Enzymes [BR:caf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AL524_10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AMG53510
UniProt: A0A0X8S1C5
Position
complement(2201258..2202460)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGEEYLSGLAECFHLPEARIKWKMDGGKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDDSVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFFVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYTTKEDAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctcactgaaatttgcaatc
atcgatgcagttaacggtgaagagtacctttctggtttagccgaatgtttccatctccct
gaagcacgtatcaaatggaaaatggacggcggtaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaatactattctggcacaaaaaccagaa
ctgtctgcgcagttgactgcaatcggtcaccgtatcgtacacggcggcgagaagtatacc
agctccgtggttatcgatgactctgttattcagggcatcaaagattctgcctctttcgca
ccgctgcataacccggctcacctgatcgggattgcagaagcactgaaatccttcccgcag
ttgaaagacaaaaacgtggctgtgtttgacaccgcgttccatcagaccatgccggaagag
tcttacctctatgccctgccgtacagcctgtacaaagaacacggcgttcgtcgttatggc
gcgcacggtaccagccacttcttcgttacccaggaagcggcaaaaatgctgaacaaaccg
gtagaagagctgaacatcatcacgtgccacctgggcaacgggggttctgtttctgctatc
cgcaatggtaaatgtgttgatacctctatgggcctgaccccgctggaaggtctggtgatg
ggtacccgctctggtgacatcgacccggcaatcattttccacctgcacgacacgctgggc
atgagcgttgatcagatcaacaagatgctgaccaaagaatccggcctgctgggtctgacc
gaagtgaccagcgactgccgttatgttgaagacaactacaccaccaaagaagacgcgaaa
cgtgcaatggacgtttactgccaccgtctggcgaagtacatcggttcctacacggcgctg
atggacggtcgtctggacgcggttgtcttcaccggcggtatcggtgagaacgcggccatg
gttcgcgaactgtccctgggtaaactgggcgtgctgggctttgaagttgatcatgaacgt
aacctggctgcccgtttcggcaaatctggtttcatcaacaaagaaggtacccgtcctgcg
gtggtgatcccaaccaacgaagaactggttatcgcgcaagacgcgagccgtctgactgcc
tga

DBGET integrated database retrieval system