KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_12320Help
Entry
AL524_12320       CDS       T04738                                 

Definition
(GenBank) decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00860  Porphyrin and chlorophyll metabolism
caf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AL524_12320
Enzymes [BR:caf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     AL524_12320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 PrmA GidB Methyltransf_25 Methyltransf_4 Methyltransf_12 Cons_hypoth95 PCMT Methyltransf_11 Met_10 CMAS Methyltransf_18 Methyltransf_2 Methyltransf_23 RrnaAD DOT1 UPF0020 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: AMG53815
UniProt: A0A381G8L1
Position
2546560..2547129
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGEKVPMTKEAVRALALAKLELHRASHLIDIGAGTGSVSIEAALQFPSLHITA
IERNPAALRLLDENRQHFACANIDILPGEAPMMMTEKADAVFMGGSGGHLTELIDWSMRQ
LHVGGRLVMTFILQENLNTALAHLQQRGVQDVDCLQMQISSLTTLGAGHYFKPNNPVFVI
ACQKEERHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagcttttcctgcgcggtgagaaggtgccgatgaccaaagaagcggtacgt
gcgctcgctctcgcaaaacttgaactgcaccgggccagtcacctgattgatatcggggcc
ggaaccggcagtgtgtccatcgaagccgcgctacagtttccgtcgctacacatcacggct
atcgagcgcaatccggcggcgctgcgtttactcgacgaaaaccgtcagcatttcgcctgc
gcgaatatcgatattctgccgggtgaagcgccaatgatgatgaccgagaaagccgatgcc
gtctttatgggtggcagtgggggacatctcacggaactgatcgactggtctatgcgccag
ttgcacgttggtggacgcctggtgatgacattcatcctacaggaaaacctcaacaccgcg
ctggcacatctgcaacagcgcggtgtgcaggacgtggactgcctgcaaatgcagatttcg
tcgctgaccacgctgggcgcgggtcactatttcaaaccgaacaatcccgtttttgtcatc
gcctgccagaaggaagaacgccatgtctga

DBGET integrated database retrieval system