KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_14665Help
Entry
AL524_14665       CDS       T04738                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00620  Pyruvate metabolism
caf00630  Glyoxylate and dicarboxylate metabolism
caf01100  Metabolic pathways
caf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL524_14665
   00630 Glyoxylate and dicarboxylate metabolism
    AL524_14665
Enzymes [BR:caf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AL524_14665
    1.2.1.22  lactaldehyde dehydrogenase
     AL524_14665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMG54233
UniProt: A0A381G7S7
Position
3019107..3020546
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHPMYIDGQFVTWHEDAWIDVINPATEEVISRIPDGRAEDARKAIAAADRAQAEW
EALPAIVRAGWLRKIAAGIRERAGEISALIVAEGGKIQQLAEVEVSFTADYLDYMAEWAR
RYEGEILQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKLAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVAAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINTGQVCNCAERVYVQKGIYDL
FVNRLGEALKAVQFGNPGERNDIAMGPLINAAALQRVEQKVARAVQEGARVALGGKAVEG
KGYFYPPTLLLDVRQEMAIMHEETFGPVLPVVVFNTLEEAIAMANDSDYGLTSSIYTQNL
NVAMKAINGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLNEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgtacaacatcctatgtatatcgatggacagtttgtgacctggcacgag
gatgcctggattgatgtcatcaacccggcgacggaagaggtgatttcgcgtattcctgat
ggtcgtgcagaagacgcgcgcaaagccattgcagcggcggaccgtgcgcaggctgagtgg
gaagcgctgccagcgatcgttcgtgctggctggctgcgcaaaattgccgccgggatccgt
gaacgtgctggcgaaatcagtgccttaattgtggctgaaggaggaaaaattcagcaactg
gccgaggtggaagtctcttttactgccgactatctcgactatatggcggagtgggctcgt
cgctatgaaggcgaaattctgcaaagcgatcgccctggcgagaatatcttgctgtttaag
cgcgcgctgggggtcaccaccgggatcctgccgtggaatttcccgttcttcctgatcgcc
cgtaagctggctccggccctgttgaccgggaacaccatcgtgattaaacccagcgaattc
acgcccaataacgcgattgcgtttgccaaaattgttgatgagattggtctgccgcgtggt
gtgtttaacctggtgctggggcgtggtgaaaccgtcggccaggaactggccggtaacccg
aaagtggcgatggtcagcatgaccggcagcgtggcagcaggtgaaaagattatggcgact
gcggcgaaaaatatcaccaaagtgtgcctggagttgggtggcaaggcgccagcgattgtg
atggatgatgccgatcttgaactggcggtcaaagcgattgtggattcccgggtcatcaat
accggacaggtttgtaactgcgcggagcgtgtctacgtacaaaaagggatttatgacctg
ttcgtgaaccgcctgggcgaagccctgaaagcggtacagttcgggaatccaggcgagcgt
aacgatatcgccatggggccgcttatcaatgccgcggccctgcaacgtgtggagcagaaa
gtggcgagggcggtacaggagggggcgcgggtggcgctcggcggcaaagccgttgagggc
aaaggttacttctatccgccaacattgctgttggatgttcgtcaggagatggccatcatg
cacgaagagacctttggccctgtgctgcctgtggtggtcttcaacacgctggaggaggct
atcgcgatggctaatgacagtgattacggcctgacatcgtctatttatacgcagaatctc
aacgtcgcgatgaaagccattaacgggctgaagtttggtgagacttatattaatcgcgag
aactttgaagcaatgcagggcttccacgcgggatggcgtaagtcggggattggcggcgca
gacggcaagcacgggctgaacgagtatctgcaaacccaggtggtttatttgcagtcctga

DBGET integrated database retrieval system