KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_17395Help
Entry
AL524_17395       CDS       T04738                                 

Definition
(GenBank) aminotransferase class V-fold PLP-dependent enzyme
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00780  Biotin metabolism
caf01100  Metabolic pathways
Module
caf_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AL524_17395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:caf01007]
    AL524_17395
Enzymes [BR:caf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     AL524_17395
Amino acid related enzymes [BR:caf01007]
 Aminotransferase (transaminase)
  Class II
   AL524_17395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Speriolin_C
Motif
Other DBs
NCBI-ProteinID: AMG54729
UniProt: A0A381G5S3
Position
complement(3601783..3602955)
Genome map
AA seq 390 aa AA seqDB search
MSLYDKFSRLACEREQFSMAGINPFGTCIDEVFSATEGRIGNQKIILAGTNNYLGLTFNP
QAIAEGQAALASQGTGTTGSRMANGSYGPHLALEKEIAEFFERPSAIVFSTGYTANLGII
STLASHNAVVLLDADSHASIYDACALGGAEIIRFRHNDAKDLERRMMRLGERAKDAIIIV
EGIYSMLGDIAPLVDIVEIKKRLGGFLIVDEAHSFGVMGAKGRGLAEAAGVEQDVDIIVG
TFSKSLASIGGFAVGDQGMDVLRYASRPYIFTASPSPSSIATVRSALKTIATQPELRQKL
WDNAARLYEGLEKLGYELSSHISPVVPVIIGAKEEGLRIWRELIAAGVYVNLILPPAAPA
GITLLRCSVNAAHTYEQIDAIIQAFAQLKK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtctctatgataaattttcgcgcctggcctgcgagcgagaacaatttagcatggca
ggaattaacccatttggcacctgtatcgatgaggtgttttccgcaacggaaggacggatt
ggcaaccaaaaaattattctggcaggtacgaataactatctggggctcacctttaatcca
caggcgattgccgaggggcaggccgctttagccagtcaggggacaggcacgaccggttca
cgaatggcgaatggcagctatggaccacatttagccttagaaaaggagattgccgagttt
tttgagcggccatcagccatcgtattctccacaggctataccgcgaatttggggataatc
agcacgcttgccagtcacaatgccgtggtattgctggatgctgacagccacgccagcatt
tatgatgcctgcgcgttaggtggagctgaaattatccgctttcgccataatgacgcgaaa
gatctcgagcggcgcatgatgcgccttggtgagcgcgccaaagacgcgatcatcattgtc
gaaggcatttacagcatgctgggcgacattgcgccactggtcgatattgtcgagatcaaa
aaacggttgggtggctttttaattgtcgatgaagcccattccttcggcgtgatgggcgcg
aagggacggggactggcggaagccgccggtgtggagcaggatgtcgatattattgtggga
accttcagtaagagcctggcttctattggtggttttgccgtcggcgatcagggcatggat
gtcctgcgttacgccagtcgtccctacatttttaccgcatccccatcgccatcgagcatt
gcaaccgtccgctctgcgttgaaaacgatcgcaacacaaccggagctgcgccaaaagctg
tgggataacgcagcgcgactgtatgaagggcttgagaaactgggctatgagctgagttcg
cacatcagccctgtggtgccggtgattattggcgcaaaagaagagggactgcgtatctgg
cgagaactgatcgccgctggcgtttatgtgaatctcattttgccaccggctgcccccgcc
gggattacgttgctgcgttgcagtgttaatgccgcgcatacctacgagcagattgacgcg
attattcaggcatttgcacagctgaaaaaataa

DBGET integrated database retrieval system