KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_22640Help
Entry
AL524_22640       CDS       T04738                                 

Gene name
glpX
Definition
(GenBank) fructose-bisphosphatase class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00010  Glycolysis / Gluconeogenesis
caf00030  Pentose phosphate pathway
caf00051  Fructose and mannose metabolism
caf00680  Methane metabolism
caf01100  Metabolic pathways
caf01110  Biosynthesis of secondary metabolites
caf01120  Microbial metabolism in diverse environments
caf01130  Biosynthesis of antibiotics
caf01200  Carbon metabolism
Module
caf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL524_22640 (glpX)
   00030 Pentose phosphate pathway
    AL524_22640 (glpX)
   00051 Fructose and mannose metabolism
    AL524_22640 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    AL524_22640 (glpX)
Enzymes [BR:caf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AL524_22640 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AMG55663
Position
complement(4735917..4736888)
Genome map
AA seq 323 aa AA seqDB search
MKSLAWPLFRITEQAALAAWPQTGCGDKNKIDGLAVSAMRTALNDIAIRGRIVIGEGEID
HAPMLWIGEEVGSGSGPEVDIAVDPIEGTRMVAMGQSNALAVMAFAPRGSLLHAPDMYMK
KLVVNRQAKGVINLARPLADNLRQVAKALGKPLDRLRMATLDKPRLQPAIAEATQLGVKV
FALPDGDVAASVLACLQDNPYDLMYTIGGAPEGVISACAVKALGGDMQAELIDFCEAKGD
TAEHRVISAQERQRCAEMGVEVNRIYTLDELVAGHDVLFSATGVTGGDLVNGIQQVAKGV
RTQTLLIGGADRTCNIIDSLHSW
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgttggcatggccgctgtttcgcatcacagagcaggcagcgctggctgcctgg
ccgcaaaccggctgcggcgataagaacaaaatagatggactggcagtgagtgcgatgcgc
acggccttgaatgacatcgctattcgcgggcgcatcgtcattggtgagggcgagattgat
cacgcgccgatgctgtggattggcgaagaggttggcagcggcagcgggccagaggttgat
atcgcggtcgatcctattgaaggcacccggatggttgcgatggggcagagcaatgcgctg
gcggtgatggcgtttgcgccgcggggaagcttgttacatgcccctgatatgtacatgaaa
aagctggttgttaaccggcaggcgaaaggggtgattaacctggcgcggcccctggcggat
aatctgcgtcaggtggcgaaagcgctgggcaaaccgctggatcgactgcgcatggccacg
ctggataaaccgcggcttcagccagccattgccgaagccacgcagttgggggtgaaagtc
tttgccctgcctgatggtgatgtggccgccagtgttctggcctgtttgcaggataaccct
tatgacctgatgtataccattggcggtgcgccagaaggcgtgatttccgcctgcgcggtg
aaagcgttggggggggatatgcaggccgagctgatcgatttttgtgaagcgaaaggcgac
accgcggagcatcgtgttatctctgcccaggagcgccagcgctgcgcggaaatgggcgtc
gaggtcaatcggatctatacgctcgacgaactggtagcgggacatgacgtcctcttcagc
gcgaccggagtgaccggcggcgatcttgtgaatgggatccaacaggttgcaaagggggtg
cgtacgcaaactttactgatcggcggcgcggatcgaacgtgtaatataatagactctctg
cattcatggtga

DBGET integrated database retrieval system