KEGG   Chloroflexus aggregans: Cagg_0239Help
Entry
Cagg_0239         CDS       T00824                                 

Definition
(GenBank) magnesium chelatase, H subunit
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag00860  Porphyrin and chlorophyll metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cagg_0239
Enzymes [BR:cag01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cagg_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479
Motif
Other DBs
NCBI-ProteinID: ACL23187
UniProt: B8GCY7
Position
complement(299311..303120)
Genome map
AA seq 1269 aa AA seqDB search
MSQPTEFVMVLGLQQYSQDFFRRAEAEVRKEVPDFRLHIFEDRDVTARPAEVEAAIARCR
CLILSLITLNETAEVLIPMVERHDPPVVFSFEGLPEVMRLNKVGSYNLKAGKGMPKPVQN
VARLLVGGREEDALYGYVKLQKITSKLINFLPGKRLNDFRNWTNVNNYWTHRSIANAANM
FKLILREYSGMSHLRVDPVVELPNMGFAHPDAPKLFASPAEYERWEKERNRARKGAPAPL
GTVAVLSFRAHILSGADYHHKIVHALEAAGLRVLPIFVMGIESHIVVREWLSHMKVDLII
NTMGFPLVGGPAGSTKAGLTVDVARELLSKLDVPYIVAQPLFVQDEDDWRERGVGPLQST
FLYSLPEMDGAIAPVVLGGMRGSTITTVPDRLERLARIARGFVRLRKKANREKKVAIIVY
NYPPGQGKVATAALLDVPASLIAILDRLAAEGYQVGRYPRDPETFARCLEGLVSDQPLPP
GHPPVVMGISADLQDFYRWLRPVDQERINARWGAFPGDIAPLGRDKVRLAGTQIGNIFIG
VQPVIGMPGDPMRLLFDKENTPHHQYALFYRYLSESFDADAIIHLGMHGTAEWMPGLQLG
LTDRCWPDVLLGEVPNFYVYPINNPAEANIAKRRGYSTIIGHAIPPYGRAGLYRELQALQ
DLLAEYRERPASVADDDQSPEAIAIMQKIALLNLDHDLVRQPDEPFSRFASRAYAYLRDL
AATMITDRLHVLGSAPPPEEQLTLIVETLKVPRGELPGLADLFLTARHATVRYGELLSRA
RQGDAEALALRDEIEERCTDFVHQTVFGHLSPEQAAQQFGLPAGNEVQGLIQHGRALLAA
LRDNTQELDYLVRGLAGRYIPAAPGGDIIRDGVTVLPTGRNIHSLDPFRVPTDSAYERGV
RIAEALIAAHRAETGQYPETIAQVLWGLDAIKTKGESIGIVLGLIGARPVKDGQGKVGRY
ALIPLTELGRPRVDVLMTASGIFRDIFAGTMDMLDRLVREAAAADEPVEMNYIRKHVQEM
MAAGKSFDQATARIFTQAAGTYGTDVDEAIEGSAWEKREELEDLFIKRNAYAFGGRQNGE
AQPEVLRALLGTVSRVAQEIDSVEYGLTDMQHYYGYSGALKAAAERATGQRVPLNFVESF
TAETKLQTLEQTLRVEYRTKFLNPKWYEGMLRHGHNGAAEIASRFTYMLGWSATTDAVDK
WVYDEAAKTFVLDDAMRTRIEQLNPAAARNMVGRLLEANARGIWQTDEETLERLRELHAD
LEDRLEGVA
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgacagagtttgtgatggtgctcggcttgcagcagtatagtcaggatttc
ttccgtcgtgctgaggccgaggtgcgcaaagaagttcccgactttcgcttgcatatcttt
gaagatcgtgacgtgaccgcacgacctgctgaggttgaagcggcaattgcacgctgccgg
tgtttgatcctctcgctcattacgctcaacgaaaccgccgaagtcctcatcccaatggtg
gaacggcacgatccaccggttgtcttttcgtttgaggggctgccggaggtgatgcggctc
aataaggtcggctcgtacaacttgaaggccggtaaaggcatgccgaaaccggtgcaaaat
gttgcccgcttgcttgtgggtggccgtgaagaagatgccttatacggttatgtcaagtta
caaaagattacctcaaagctgatcaatttcttgcccggtaaacgcctcaacgattttcgc
aactggaccaacgtcaataactactggacgcaccgcagtatcgccaacgcggcgaatatg
tttaagctaatcttacgtgagtatagcgggatgagccatctgcgcgttgatccggtagtt
gagctgccgaatatgggttttgctcatcccgatgcgccaaagctgtttgccagcccggct
gaatatgagcgttgggaaaaagaacgtaaccgtgcccgtaaaggcgcaccggcaccgctc
gggacggtggcagtgttgtcattccgcgcccatatcctttccggggccgattaccatcac
aaaattgtgcatgcactcgaagccgccggtctgcgggtactgccgatttttgtgatgggc
atcgagagccatatcgtggtacgtgaatggcttagccacatgaaggtcgatctgattatc
aatacgatgggctttccattggttggtggtcccgccggttcgaccaaggccggtttgacg
gttgatgttgcccgcgagttgctcagtaagctcgatgtaccgtatatcgtcgcccaaccg
ctgtttgtccaggatgaagacgattggcgtgagcgcggtgtggggccattgcagagcacc
ttcctctatagcttgcccgaaatggacggtgcgattgcaccggtggtgctcggtgggatg
cgtggcagtacgatcacaacggtgccagaccgtctcgaacggctggcccgcattgcccgt
ggctttgtccgcctgcgcaagaaggccaaccgcgagaagaaggtggcgattatcgtctat
aattatccgcccggtcaaggcaaggtggcgacagcggctctgctcgatgtgccggccagc
ttgatcgccatactcgaccggttggccgccgaggggtatcaggttggtcgttatccgcgc
gatcccgagacgttcgcccgctgccttgagggtttggtgagcgatcagccactgccaccc
ggccatccgccggtggtgatggggataagcgccgatctgcaagatttctaccgctggctg
cgacccgtcgatcaagagcggatcaatgcccgttggggcgccttccctggtgacattgcc
ccgttggggcgcgataaggtgcgtttggccggtacccagatcggcaatatctttatcggt
gtgcagccggtgatcgggatgcccggcgatccgatgcggttgctgttcgataaggagaat
acgccgcaccaccagtatgcgctcttctaccgctacctcagcgaaagcttcgacgccgac
gcgatcatccatctcggtatgcacggtactgccgagtggatgcccggtttgcaactcggt
ctcaccgatcgctgctggcctgatgtgttgctcggcgaggtgcctaacttctacgtctat
ccgatcaataacccggctgaggccaatatcgccaagcggcgcggctatagcacgattatc
ggtcatgccattccgccatacggacgggccggtctttaccgcgagttgcaggccctgcaa
gacctgctggccgagtatcgcgagcgcccggcgtcggtcgccgatgatgatcaaagccct
gaagcaatcgcgattatgcagaagatcgcactgctcaatcttgaccacgatctggtgcgc
cagcccgatgagccgtttagtcggtttgcatcacgtgcctatgcctacctgcgcgatctg
gcagcgaccatgattaccgaccggttgcatgtgctgggtagcgccccaccacccgaagag
caattgaccctgatcgtcgagacgctcaaagtgccgcgcggcgaattgcccggtctcgcc
gatttgttcctcacggcacgtcatgccacggtgcgctacggtgagttgctgagtcgggca
cgacagggtgatgccgaagccttggccctgcgcgacgagattgaggagcggtgtaccgat
ttcgtccaccagaccgtctttgggcatctgtcgcctgagcaggctgcacaacagtttggc
ttgcccgccggcaatgaggtgcagggattgatccagcacggacgggcattgctggcagcg
ttacgcgataatacgcaagaactcgactatctcgtccgtggcttggccggacgctatatt
ccggcagcccccggcggcgacattatccgcgatggggtgacggtgctgcctaccggacgc
aacatccatagcctcgaccccttccgggtgccgaccgacagcgcctacgaacgcggggtg
cggatcgctgaggcgttgattgctgcgcatcgagctgaaaccggccagtaccccgaaacg
attgcccaagtgttgtgggggcttgatgcgatcaagaccaagggtgagtcgattggtatt
gtgcttggcctgatcggcgcgcgtccggtgaaggatgggcaaggcaaggtcggtcgctac
gcgctcatcccgctgaccgagctgggacgcccacgggtggatgtgctgatgaccgcctcc
ggtatcttccgcgacatcttcgccggcacgatggatatgctcgaccgattggtacgggaa
gcggcggcagccgatgagccggttgagatgaactacatccgcaagcacgtgcaagagatg
atggctgccggcaagagttttgatcaggcgacggcgcgcatcttcacgcaggcagccggt
acctacgggaccgatgtggatgaggcgattgagggcagcgcgtgggagaagcgcgaagag
ctggaggatctgttcatcaagcgcaatgcctacgcctttggcggacggcagaatggcgaa
gcgcaacctgaagtcttgcgtgccctcctcggcaccgtcagtcgtgtcgcccaagagatt
gacagtgtggagtatggcttgaccgacatgcaacactactacggctattcgggggcgctg
aaggcggcggccgagcgggcaacgggacagcgcgtgccgctcaacttcgtcgagagtttt
actgccgaaaccaagctgcaaacgcttgagcagaccttgcgggtggagtatcgcaccaag
ttccttaacccgaagtggtatgaaggcatgctgcgccacggccacaacggcgccgccgag
atcgctagccgcttcacctatatgctcggctggagcgcaacgaccgacgcggttgacaag
tgggtgtacgatgaagcggcaaagaccttcgtgctcgacgatgccatgcgcacgcggatc
gagcaactcaatccggcagcagcccgcaatatggtggggcgcttgcttgaagccaacgcg
cgtgggatctggcagaccgacgaggagacgctggagcggttacgtgagttgcatgccgat
ctcgaagaccgcctcgaaggagtagcataa

DBGET integrated database retrieval system