KEGG   Chloroflexus aggregans: Cagg_0940Help
Entry
Cagg_0940         CDS       T00824                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cag  Chloroflexus aggregans
Pathway
cag00051  Fructose and mannose metabolism
cag00520  Amino sugar and nucleotide sugar metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cagg_0940
   00520 Amino sugar and nucleotide sugar metabolism
    Cagg_0940
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Cagg_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 DUF4954 Bactofilin
Motif
Other DBs
NCBI-ProteinID: ACL23858
UniProt: B8G6C1
Position
1169493..1170605
Genome map
AA seq 370 aa AA seqDB search
MKAVILVGGQGTRLRPLTCRTPKPMLPLVNQPFIEWMLLRLRDYGIREVILAVQYLADRF
RTALGDGSHLDMRLHIVEEPEPRGTAGAVKHVEHLLDGTTFIFNGDVMTDLDLKAMLDFH
RERGSKVTISLTPVDDPTQFGLVETDRDGRVRRFLEKPRLEDITTNFVNAGTYLIEPEIF
RYVPPNQFYMFERGLFPVVLQTGDPMYGFPSRAYWTDIGKPQTYLDVHHDILIGKVQYHF
RGQQVGERIWVEGEVDIHASAQIVGPVVIGHGTRIGRGTRIIGPTVIGERCEIGPECQIE
GVVMWERNVIEEGVTLRNCVLGSGNRIGERSHIIDGTIISDECHIGQENRLERGIRIWPG
TTLGDRAISF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaatcctcgttggcggccagggtacacgtttgcgtccgctcacctgccgc
acacccaaaccaatgctaccactggtcaatcagccgtttatcgaatggatgttgctccga
ctgcgcgattacggcatccgcgaagtgatcctggccgtccagtatctggccgaccgcttc
cgtaccgccctcggtgatggttcgcatctcgatatgcggctccacatcgtggaagagcct
gaaccgcgtggtactgccggcgctgtcaagcacgtcgaacatttactcgatggaacgacg
ttcatttttaacggcgatgtgatgaccgatctcgacctgaaggcaatgctcgattttcac
cgtgaacggggcagtaaagtaaccatctcgctcacgccggttgatgatccgacccaattc
ggtttggttgagaccgatcgcgacggacgtgtgcgccggtttctggaaaaaccgcgtctt
gaggatattacgaccaattttgtcaatgccggaacgtatctgatcgaacctgagatcttt
cgctacgtaccgcccaatcagttctatatgtttgaacgtggcctcttcccggttgtgctt
cagaccggtgacccaatgtacggttttccatcgcgcgcctactggaccgatatcggcaag
cctcagacatatctcgatgtgcatcacgatattttgatcggcaaagttcagtatcatttt
cgcggccaacaagtaggtgaacgtatctgggtagaaggggaagtggatattcatgcaagt
gctcaaattgttggtccggttgttatcggtcacggcacccggattggtcgcgggacacgc
attattggcccaacggtgatcggcgaacggtgtgaaattggtcctgagtgtcaaatcgag
ggcgttgtgatgtgggaacgcaacgtgatcgaagaaggcgtgaccctgcgcaattgtgta
ttgggttccggcaaccggatcggtgagcgatcgcacatcatcgatggcacgattatcagc
gacgagtgccacattggacaagaaaaccgccttgaacgcggtattcgtatctggcctggt
acgactctcggtgatcgagccatctcgttttag

DBGET integrated database retrieval system