KEGG   Chloroflexus aggregans: Cagg_1126Help
Entry
Cagg_1126         CDS       T00824                                 

Definition
(GenBank) Aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cag  Chloroflexus aggregans
Pathway
cag00350  Tyrosine metabolism
cag00360  Phenylalanine metabolism
cag00380  Tryptophan metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Cagg_1126
   00360 Phenylalanine metabolism
    Cagg_1126
   00380 Tryptophan metabolism
    Cagg_1126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cag04147]
    Cagg_1126
Enzymes [BR:cag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Cagg_1126
    4.1.1.105  L-tryptophan decarboxylase
     Cagg_1126
Exosome [BR:cag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cagg_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ACL24036
UniProt: B8G779
Position
1392055..1393470
Genome map
AA seq 471 aa AA seqDB search
MMHPDEFRRIGYQIIDMIADYRATIANRPVWSQLRPGEFRSQLPATPPEQPEPPEAILAD
VERLIIPGLSNWQHPRFFGYFPANASLASLLGDFLSGGLGQLGLNWQASPPLTELEELTT
DWMRQLLGLSEAWRGVIQDTASTSTLVALLCARERASDHSQVRGGLQALPQPLVVYTSIQ
SHSSVEKAALLAGFGRDNLRLLPVDDTFALRVDTLADAIATDRAAGRVPCAVVASIGATA
TTACDPLEPIGELCRREGIWLHVDAAMAGSAMILPECRYLWQGIEQADSLVLNPHKWLGA
AFDCSLYYVRDPQHLIRVMSTNPSYLQTSADGAVTNYRDWGIPLGRRFRALKLYFLLRCE
GAEGLRTRLRRDIANARWLAEQIDATPHWRRLAPVPLQTVCVRHEPPGLTGEDLDRHTLR
WVGAINASGAAYLTPAMLDGRWMVRISIGAEPTEHTDVAALWALMQEVVRG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatcctgacgaattccgccgtattggctaccagatcatcgacatgatcgccgat
taccgtgcaaccatcgccaaccgtccggtctggtcacagttgcgtcccggcgagtttcgt
agtcagttgccggccaccccacctgaacagccggaaccaccggaagcgatcctcgccgat
gtggaacgtctgatcatccccggtttatcgaactggcaacacccccgctttttcggttat
tttccggccaacgctagcctcgcttcactgttgggcgattttctcagtggtggtctcggt
caattgggtttgaattggcaggctagcccaccgttaaccgaactcgaagagctgacaacc
gactggatgcgacagttgctgggcttgagcgaggcgtggcgcggggtaattcaggatacg
gcaagcaccagtacgctggtggcgttgctctgtgcccgtgaacgggccagcgaccatagc
caggtgcgcggcggcttgcaggcgctgccgcagccgctggtggtctatacctcaatccag
agccacagttcggtggagaaggcggcgctgttagccggttttggccgcgataacctccgc
ctgttgccggttgacgataccttcgccctgcgcgtggacacactcgccgatgctattgct
accgaccgcgccgccggtcgagtaccgtgcgcggtggtggccagtatcggcgcaacggca
accaccgcctgtgatccgctcgaaccgattggcgaactgtgccggcgtgaggggatttgg
ctgcacgttgatgcggcaatggccggctcggcgatgatcttgcccgaatgtcgctatctc
tggcaggggatcgaacaggccgatagccttgtcctcaatccgcacaaatggctgggggcg
gcgttcgattgctcgctttactacgtgcgcgatccgcagcatcttatcagagtgatgtca
accaaccccagttatttgcaaaccagcgccgacggcgctgtcaccaactatcgcgactgg
ggcattccgttgggccggcgcttccgcgcgctgaagctctacttcttgctacgctgcgaa
ggggccgaggggttgcgcacccgcctgcgccgcgacatcgctaatgctcgctggctggct
gagcagatcgacgcgacgccgcactggcggcgattggcgccggtaccgctccagacagtc
tgcgtgcgccacgaaccacccggtctgaccggtgaagaccttgatcgccataccttacgc
tgggtaggcgcgattaatgccagcggtgcagcgtacctgacccctgcgatgctcgatggc
cgttggatggtgcggatcagcattggcgccgagccaaccgagcacactgatgtggcggcg
ctgtgggcattgatgcaagaggtggtacgagggtag

DBGET integrated database retrieval system