KEGG   Chloroflexus aggregans: Cagg_1141Help
Entry
Cagg_1141         CDS       T00824                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
cag  Chloroflexus aggregans
Pathway
cag00900  Terpenoid backbone biosynthesis
cag01110  Biosynthesis of secondary metabolites
cag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cagg_1141
Enzymes [BR:cag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Cagg_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ACL24051
UniProt: B8G794
Position
1409511..1410833
Genome map
AA seq 440 aa AA seqDB search
MGTKNSRLQGFYQLNPFERLQMVKSFDGLVDEDLRALHGGQGGALTLERADKMIENVVGT
YNLPLGIATNFRINGRDYLIPMVVEEPSIVAGASYAARMVRDGGGFETSSTEPLMIGQVQ
LVNIANPDQAREAILARKDEILALANAQSRSLVALGGGARDVEVRFFPTSPMGPMLVVHL
IVDCRDAMGANAVNTMAEAVAPLLADITGGKVYLRILSNLTDRRLARARCVVPAASLARD
GLSGEEVVEGILWAYAFAAVDPYRAATHNKGIMNGIDPILVATGNDWRAVEAGAHAYASR
NGRYTSLSHWERDENGNLVGTLEMPLSVGIVGGATKVHPTAQAALKLLGVRSANELAEVC
VAAGLANNLAAMRALACEGIQQGHMSLHARQIALAAGATGTLVDEVARRMVAERNIKPAR
AEEIIAELERRQHAGNPSHN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggggaccaagaattctcgtctacaaggcttttaccaactgaatccgttcgagcgattg
cagatggttaaatcatttgatgggttagttgacgaagacctacgggcgctccacggtggt
cagggtggcgcgctgaccctcgagcgcgccgacaaaatgatcgaaaacgttgttggtacg
tataatctaccccttggcattgcaaccaacttccgtattaacggacgcgactatttgata
ccgatggtagtagaagagccatcgattgtcgccggcgcgagctatgccgcccgtatggtg
cgtgacggtggtgggttcgagaccagcagcaccgaaccgttaatgatcgggcaggtacaa
ttggtcaatattgccaaccccgatcaggcccgtgaagccatccttgcccgcaaggacgag
attttggcgctggccaacgcacagagccgatcgctggttgcacttggtggcggtgcgcgc
gatgttgaagtgcgcttcttccccaccagcccgatggggccgatgttggtcgtccacctt
atcgttgattgccgtgacgcaatgggcgccaatgcagttaacacaatggccgaggcagta
gcaccgctattagccgacataaccggtggtaaggtttatctgcgcatcctctcgaatctg
accgatcggcggctagcccgtgcccgctgcgtcgtaccggcagcctccttggcccgtgat
ggtctcagcggcgaggaggtggtcgagggtattctctgggcttacgcctttgctgcggtt
gacccgtaccgggccgcaacccacaacaaaggcattatgaacggtatcgatccaatactg
gttgccaccggcaacgactggcgtgcagtggaagccggtgcgcacgcctacgccagccgt
aacggtcgttacacctcgctctcgcactgggagcgcgatgagaatgggaatctggtcggc
accctcgaaatgccactctcggttggtatcgtcggtggggcgaccaaggtgcatcccacg
gcccaagctgcgttgaagttgctaggagtgcgcagcgccaacgagctggctgaagtgtgt
gttgctgccggcttagccaacaacctcgcggcaatgcgggcattagcttgcgagggcatc
cagcagggccatatgagcttgcatgcgcgccaaattgcactggcagccggcgcaaccggt
acactggtcgacgaagtcgcccgccggatggtcgccgagcgcaatatcaagccggcacgc
gccgaagagattattgccgaactcgaaagacgacaacacgccggcaatccctcccacaac
tga

DBGET integrated database retrieval system