KEGG   Chloroflexus aggregans: Cagg_1290Help
Entry
Cagg_1290         CDS       T00824                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cag  Chloroflexus aggregans
Pathway
cag00860  Porphyrin and chlorophyll metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cagg_1290
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cagg_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ACL24198
UniProt: B8G819
Position
1589041..1589805
Genome map
AA seq 254 aa AA seqDB search
MSVLVGRRIAITRPAGRGDTLAARLRALGAIPLLTPLIAYAPPADPAPLQHALAQLAAGT
YDWLVVTSRQAVQVLAEATVPTTTAIAAVGKATAADCRRTWGREPAGVPDEELGAALPNV
MGTLTGKRILLPCADIAPSTLTAALQAAGAIVDRVTAYRTISSPAAAELAAALRSGTIDA
IVLASGSAARQIPALLPPQTQCPPLVCIGPSTAAVCTELGLPVAAIAIRPNDDALLAALE
RVFLSQDAQPVSGF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgtaggtcgtcggatagccatcacccgtccggcaggccgcggcgataca
ctcgctgcacgattgcgcgcactcggcgccattccgttactcacgccgctcatcgcgtat
gcaccacctgccgatccggccccactgcaacacgcgctggcccaactcgctgccggcacg
tatgattggctcgtggtcacaagccggcaagcggtccaagtgttagccgaggccacagtg
ccgacaaccacagccatcgctgctgttgggaaggcaaccgctgccgattgccgccgcacc
tgggggcgcgaaccggccggtgtacctgatgaggaactcggagccgcgctaccgaacgtt
atgggcacgctcaccgggaagcggatattgctgccgtgcgccgacattgccccatcaaca
ctgaccgcagcactccaagcagccggtgcaattgttgatcgggtaactgcctaccgcacg
atcagtagtccggctgccgccgaactcgccgctgcgctacggagcggtacgattgatgca
attgtactggccagcggatcggccgctcgccaaataccggccctcttgccgccacaaact
cagtgtccaccattagtctgcattgggccgagtactgctgccgtctgcacagaattggga
ctaccggttgccgccatcgctatacgccccaacgacgatgcattgctggcggcgttggaa
cgggtttttctcagtcaggatgcgcaacctgtgagcgggttttga

DBGET integrated database retrieval system