KEGG   Chloroflexus aggregans: Cagg_1709Help
Entry
Cagg_1709         CDS       T00824                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
cag  Chloroflexus aggregans
Pathway
cag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cagg_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACL24610
UniProt: B8GAM1
Position
2089409..2089798
Genome map
AA seq 129 aa AA seqDB search
MSGQRNLPKYLWFYSICLMIIAVVGGCNQTEPPDPITEGQRIYTIYCLGCHSLDPAGPAA
LGPPLAGIGTRAANNSEGLSATEWLRREIINPDVVVAPGYTAGLMPRTYGTDFRPVQLEA
LIAYLASLE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccaacgtaatctgccgaagtatctgtggttctacagtatctgtctgatgatc
attgcagtcgttggcggctgtaatcaaaccgaaccacccgatccaataaccgagggtcaa
cgcatctacaccatctactgtctaggctgccacagcctcgatccggcaggtcctgctgca
cttggcccaccattggccggcattggcacccgtgccgccaacaacagcgaagggctaagc
gcaacagaatggctccggcgtgagatcatcaatcctgatgtcgttgtggcaccgggatac
acggcggggttgatgccgcgcacctacggcaccgactttcgcccggtgcaactagaggca
ctcattgcgtacttagcgagtctcgaataa

DBGET integrated database retrieval system