KEGG   Chloroflexus aggregans: Cagg_2086Help
Entry
Cagg_2086         CDS       T00824                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cag  Chloroflexus aggregans
Pathway
cag00020  Citrate cycle (TCA cycle)
cag00640  Propanoate metabolism
cag00660  C5-Branched dibasic acid metabolism
cag00720  Carbon fixation pathways in prokaryotes
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
cag01130  Biosynthesis of antibiotics
cag01200  Carbon metabolism
Module
cag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cagg_2086
   00640 Propanoate metabolism
    Cagg_2086
   00660 C5-Branched dibasic acid metabolism
    Cagg_2086
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cagg_2086
Enzymes [BR:cag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cagg_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: ACL24973
UniProt: B8GCC9
Position
complement(2550382..2551530)
Genome map
AA seq 382 aa AA seqDB search
MKLHEYQARDLLARYGIPVTGGGVAVTPAEAHAIAEQIGGPVVVKAQVHVGGRGKAGGVK
LAQTPAEAEQVAGQILGMNIKGLTVEKVLVAEAISYERELYLSAILDRGSKRITMIASAE
GGVEIEEVAKTNPSAIVKIAAHPTMGLLDFQARELAFRIGLRDGKQARQFAQIAGALYRA
FVESDASLAEINPLVIKNDGNLLALDSKVLLDESGLFRHPDLAALRDPSAEPEAERRARE
ADITFIKLDGNIGCMVNGAGLAMATMDVIKLSGGEPANFLDIGGGAGKEKVKAALQIILS
DPNVKAVLFNIFGGITRVDEVARGILAALEEVPTDVPMVARLVGTNEEVGRALLAGSKLI
PAATLAEGAQKAVAAARGELVS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcatgaatatcaagcccgcgatctgttggcgcgctacggtattccggtgacg
ggtggtggagttgccgtaactccggcggaagcccatgctattgccgagcagatcggtggg
ccggtggtggttaaagcacaggtacacgtaggcggtcgtggcaaagctggtggtgtcaaa
ttagcccaaacgccggcggaagccgaacaggtggccggtcagatattggggatgaatatc
aaggggctaacggtcgagaaggtgttggttgccgaagcgattagctacgagcgcgagttg
tacctttcagccatccttgatcgtggcagcaagcgaattacaatgattgcttctgccgag
ggtggggttgagatcgaagaggtcgccaagactaacccctctgcaatcgttaagattgct
gcccacccgacaatgggtttactcgattttcaggctcgcgagttggcgttccgcatcggt
ttacgcgatggtaaacaggcacgccagtttgcccagatcgccggtgccctgtaccgcgcc
ttcgttgagtcagatgcatcattggccgagattaaccctctcgttattaagaacgatggc
aacctgcttgccctcgactccaaggtactactcgatgagagcggcttgttccgccatccc
gatctcgctgccctccgcgatccctctgccgagcctgaagccgaacggcgtgcgcgtgag
gccgatattacctttatcaagctcgacggtaacatcggctgcatggttaatggtgccggg
ctggcaatggcaacgatggacgtaattaagttgtcgggtggtgagccggccaattttctt
gacatcggaggtggtgccggcaaagagaaggtgaaggcggcattgcagattattctctcc
gacccgaacgtcaaggccgtgttgttcaatatctttggcggtattacgcgagtcgatgaa
gtggcccgtggtatccttgctgccctcgaagaggtgccgacggatgtgccgatggtggca
cggcttgtcggtaccaatgaagaggtcggtcgcgccctgctggccggttcaaagctgatc
ccggcggcaacgctggccgaaggcgcccagaaggcggtagcagccgcccgtggcgaattg
gtgagctaa

DBGET integrated database retrieval system