KEGG   Chloroflexus aggregans: Cagg_2091Help
Entry
Cagg_2091         CDS       T00824                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cag  Chloroflexus aggregans
Pathway
cag00500  Starch and sucrose metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cagg_2091
Enzymes [BR:cag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cagg_2091
Exosome [BR:cag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cagg_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ACL24978
UniProt: B8GCD4
Position
2559512..2561545
Genome map
AA seq 677 aa AA seqDB search
MSEGEQTRRTRRKQATPVTEATAPMTTAEVEHTTTEGPEPSAATTAMMKSILSEDDIYLF
NQGTHYRLYNKFGAQPVTIEGVPGTYFAVWAPNAEYVAVIGDWNNWDPGAHPLRQRGFSG
VWEGFIPHIGKGMRYKFHIASRYYGYREDKTDPFGSYFEVAPQTAAIIWDREYTWSDQQW
MSERGQRQRLDAPISIYEVHLGSWRRKPEEDNRPLTYRELAHELVEHVKACGFTHVELLP
VTEHPFYGSWGYQSTGMFAPTSRYGTPQDFMYFVDYLHQHGIGVILDWVPSHFPTDGHGL
AYFDGTHLYEHADPRKGYHPDWGSYIYNYGRNEVRSFLISSALCWLDKFHIDGLRVDAVA
SMLYLDYSRRPGEWIPNEYGGNENLEAISFLRELNTQIYKYYPDVQTIAEESTAWPMVSR
PVYVGGLGFGFKWDMGWMHDTLQYFRRDPIYRRFHHNELTFRGLYMFTENYVLPLSHDEV
VHGKGSLLDKMAGDVWQKFANLRLLYSYMFAQPGKKLLFMGGEFGQWREWSHDTSLDWHL
LMFPSHQGMLRLISDLNRLYRSEPALHELDCDPKGFEWIDANDADTSVYSFLRKNRHGET
ILVVLNATPVVREDYRVGVPFGGWWRELLNSDSEYYWGSGQGNAGGVMAEELPSHGRPFS
LRLRLPPLGALYFKHSG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaggtgagcaaacccgccgcacccggcgtaaacaagcaacaccggtcaccgaa
gcgacggcaccgatgaccacagcagaggttgaacatacgactaccgaaggacctgaaccg
tcggcagctaccacggcgatgatgaagagcattctgagtgaggatgacatttatctcttc
aatcagggcacccactaccggctctacaacaaattcggcgcccagccggtgacgattgaa
ggcgtacccggtacctatttcgcagtgtgggcaccgaatgctgaatacgtcgccgttatt
ggcgactggaacaattgggaccccggcgcacatccgctgcgccagcgaggcttttccggt
gtgtgggaagggttcattccccacatcggcaaaggcatgcgctacaaattccatattgcc
tcacgctattatggctaccgcgaagacaagaccgatccctttggcagctattttgaagta
gcaccgcaaacggcggctatcatctgggatcgggagtatacgtggtcggatcagcagtgg
atgagcgaacgcggtcagcgccagcgtctcgatgcgccgatctcgatctacgaggttcac
ctcggttcatggcgacgtaagccggaggaggataaccgccctctcacctaccgggaactg
gcccacgaactggtcgagcatgtgaaagcatgcggctttactcacgtggagctgctaccg
gtgaccgaacaccccttctacggctcgtggggctaccaatcgaccgggatgttcgcacca
accagccggtatggtaccccgcaagattttatgtactttgtcgattacctgcaccagcac
ggtattggtgtgatcctcgactgggtaccgagccactttccaaccgatggtcacggactg
gcgtatttcgacggcacgcatctctacgaacacgccgatccgcgcaaaggttatcatccc
gactgggggagctacatctacaattacggtcgcaacgaggtgcgtagctttctgatcagt
tcggccctgtgctggctcgacaagttccatattgacggtttgcgcgtcgatgccgttgcc
agtatgctctatctcgactactcgcggcgacccggtgagtggattccgaatgaatacggc
ggtaatgaaaatctggaagcgattagcttcttgcgtgaactgaacacccaaatctacaag
tattatcccgacgtgcaaaccattgccgaagagagcacagcgtggccaatggtttcgcgc
ccggtctatgtgggtgggttaggctttggcttcaagtgggatatggggtggatgcacgac
acactgcaatacttccgccgcgatcccatctaccgtcgcttccaccacaacgagctgacc
ttccgtggcctctatatgtttaccgagaactacgtactcccgctctcgcacgatgaagtc
gttcacggcaaggggtcgctgctcgataaaatggccggcgatgtttggcagaagttcgcc
aacttacgcttgctctactcctatatgtttgcccaacccggtaagaagctgctcttcatg
ggcggtgagtttgggcaatggcgggaatggtcgcacgatacgagcctcgattggcatttg
ctgatgttcccttcccatcaaggaatgcttcggctcatcagtgacctcaaccgactttac
cgcagtgaaccggctttgcacgaacttgactgtgatccgaaggggttcgagtggattgac
gccaatgatgccgataccagtgtgtatagctttttgcgcaagaatcggcacggcgagacg
attttggtggtgctgaatgcaacaccggtagtccgcgaagactaccgtgtcggcgtaccg
tttggtggttggtggcgagagttactgaacagcgattcggaatactattgggggagtggg
caaggaaatgccggtggtgtgatggctgaagaactaccatcgcatggacggccattctcg
ttgcgcttgcgcttaccgccgttgggagcgttgtacttcaagcatagcggatag

DBGET integrated database retrieval system