KEGG   Chloroflexus aggregans: Cagg_2319Help
Entry
Cagg_2319         CDS       T00824                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag00860  Porphyrin and chlorophyll metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cagg_2319
Enzymes [BR:cag01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cagg_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA AAA_16 AAA_22 MCM Sigma54_activat AAA_18 AAA_3 Viral_helicase1 AAA_30 AAA_28 AAA_2 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACL25198
UniProt: B8GDD1
Position
complement(2820711..2821763)
Genome map
AA seq 350 aa AA seqDB search
MTDEIYPFPLLAMVGQTELKTALILGLINPQIGGILISGPYGVGKTTAVRSLLDLMPFVT
RDATTSNGKPLIERMRLIELPLNARLEDVVGGINERIALEQRIVRLEEGILARAHGNVLY
VDEINLLDQAVVDAILDAAAQGRTFVRRGAMIRLFPSQFILIGSMNPEEGALRPQILDRF
GLRVWVAPVADHRARLEIYRRARDFRNDPAGFRQVYAAQTTALAEEIMIAREILPHVTIP
PELEEQALALVQRLQIPSHRAEIALLEGARARAAADFRNTVNAEDIRRIAPLALTWRHSD
WFERHTANVHTEQATINAALDELFPVSETPRRRGRRSTMRQIEDSAMDNH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgagatctatccctttccgctgttggcgatggtcggtcagaccgaactaaag
acggcgctcatccttggattgatcaacccccaaatcggtggcattctgataagcggtccc
tacggtgtcggtaagacgaccgcggtccgcagcctcctcgatcttatgccatttgtcacg
cgcgacgcaaccacaagcaatggtaagccccttatagaacggatgcggttgatcgaatta
ccgctcaatgctcgacttgaagatgttgtcggggggatcaacgagcggatcgcacttgaa
cagcggatcgttcgtcttgaagagggaattctcgcccgtgcgcacggtaatgttctctac
gtcgatgagattaacctgcttgatcaggccgtggtagatgccatcctcgacgctgcagca
cagggtcgtacctttgtacgccgtggcgcgatgatccgactctttcccagtcagtttata
ttgatcgggtctatgaacccagaagagggtgcattacgcccgcaaatcctcgatcgcttt
ggtttacgagtatgggttgccccggttgccgatcatcgtgctcggctagaaatctaccgg
cgggcacgcgattttcggaacgatccggcgggattccgacaagtctatgctgcccagacc
acggctctcgctgaagagattatgattgcccgtgagatactcccccatgtgacgattccg
ccagaattggaggaacaggcgctggcattagtacagcgtttacaaattccatcacaccgc
gccgaaatcgcactgctcgagggagcaagagcacgtgctgccgccgattttcgcaatacc
gttaatgccgaagatattcggcggattgcaccgttggcgcttacgtggcggcatagtgac
tggtttgaacggcacactgccaatgtacacaccgagcaggctacgatcaatgcagccctt
gatgaactatttccggtgagtgagacaccacgtcggcgggggcgacgcagcacgatgcgt
cagatagaagattcggcgatggataaccactag

DBGET integrated database retrieval system