KEGG   Chloroflexus aggregans: Cagg_2553Help
Entry
Cagg_2553         CDS       T00824                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
cag  Chloroflexus aggregans
Brite
Enzymes [BR:cag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cagg_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DLH FSH1 DUF676 BAAT_C Peptidase_S15 Peptidase_S9 Abhydrolase_3 Lipase_3 PGAP1 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: ACL25422
UniProt: B8G420
Position
3108026..3108811
Genome map
AA seq 261 aa AA seqDB search
MTEPYLLPRGNHACLLIHGFVGDPGEMRSLADYLAEAGLTVLGVRLPGHTGHPEDLMAVS
WRDWLAAVRQAFDWLTDCYATVSVIGFSLGGALAALLAAERPVHRLVMLATPYRLGGDWR
IDVLGVARYVVPWFYLLAQADFSSPDLRASIWRRQPDLDLDDPAIQQMLRRSIKVSVAAI
DELRLALAATRRVLPEVRTPVLIVHGRDDNTADPASASAIAARIGGVRCEIVYYPATGHQ
LLLTGPHRQMIFHRIGRFLSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaccgtatttgctgccacgtggcaaccatgcctgcttactgatccatggtttt
gtcggtgaccctggtgagatgcgcagcctcgctgattatttagctgaggctggtcttact
gtgcttggtgtgcgtctacccggccacaccggccatcccgaagacttgatggcggtcagt
tggcgtgattggcttgcggctgtgcggcaggcatttgattggttgaccgactgttatgct
accgtttcggtgattgggttttcgctcggcggggcgttggctgccctgcttgccgccgaa
cgaccggtgcatcggttggtgatgttggcgacaccgtaccgcctcggtggcgactggcgg
atagacgtgttgggtgtggcgcgttacgttgtgccgtggttttatctgttggcgcaagcc
gatttttctagtcccgatctgcgggcttccatttggcgacgacagcctgaccttgatctc
gatgatccggcaattcagcagatgttacgccgatcgattaaggtgtcggtggcagcgatt
gatgaattacgcctggcgttggcagcaactcggcgtgtgctaccggaagtacgaacaccg
gtgttgatcgtccacggtcgagatgataatactgctgacccggcaagtgcttcagcgata
gcggcacggatcggtggcgtgcgttgcgagatcgtctattatccggcgaccggccatcaa
ctgttgctgaccgggccgcaccggcagatgatttttcaccggattggccggtttttgtca
aggtaa

DBGET integrated database retrieval system