KEGG   Chloroflexus aggregans: Cagg_3601Help
Entry
Cagg_3601         CDS       T00824                                 

Definition
(GenBank) 3-isopropylmalate dehydratase, small subunit
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
cag  Chloroflexus aggregans
Pathway
cag00300  Lysine biosynthesis
cag00680  Methane metabolism
cag01100  Metabolic pathways
cag01120  Microbial metabolism in diverse environments
cag01130  Biosynthesis of antibiotics
cag01210  2-Oxocarboxylic acid metabolism
cag01230  Biosynthesis of amino acids
Module
cag_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:cag00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Cagg_3601
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Cagg_3601
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Cagg_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: ACL26439
UniProt: B8G9T6
Position
complement(4377281..4377781)
Genome map
AA seq 166 aa AA seqDB search
MARVWLFGPDINTDQIVPGRYAPYMLKDESELRRYPFVEHRPDFAPNVRPGDIIVAGKNF
GCGSSREYAPLALRMVGIGAIIAPLFARIFFRNALNLGIPCFTADLTSELADGDEVELDL
EQGRITTADGRVINLPPPPLFLREVWAAGGIVPFYRQYGRFPGEVA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgtgtggctctttggcccagacatcaataccgatcagattgttcccggccgg
tatgcgccgtatatgttgaaagatgaaagtgaactacgccgctacccgtttgtcgaacac
cgacctgatttcgcaccgaatgtgcgccccggtgacatcatcgtcgccgggaagaacttt
ggctgcggtagttcacgtgagtatgcgccgttagcactccgtatggtaggtattggtgcg
attattgctccactcttcgcgcggatcttcttccgcaatgcgctcaatctcggtattccc
tgctttaccgccgatctgacctctgaactggccgatggtgacgaagtcgaactcgatctc
gaacagggacggatcactacagccgatgggcgggtgatcaatctaccaccaccgccactg
tttttgcgtgaagtatgggctgccggcgggatcgttcccttctatcgccaatacggtcgc
tttcccggtgaggtggcgtaa

DBGET integrated database retrieval system